(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE184

PENCW_13.PE184       Location/Qualifiers
FT   CDS             join(433511..433520,433602..433706,433782..433889,
FT                   433944..434074,434131..434367)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946615"
FT                   /orf_name="Pc16g01840"
FT                   /product="Pc16g01840 protein"
FT                   /function="guanylate kinase activity"
FT                   /biological_process="purine nucleotide metabolic process "
FT                   /protein_id="CAP92854.1"
FT                   /db_xref="GO:0004385"
FT                   /db_xref="GO:0006163"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="UniParc:UPI00018316D2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H762"
FT                   /transl_table=1
FT                   /translation="MASAYRPIVISGPSGTGKSTLLKRLFAEYPDTFGFSISETTRSPR
FT                   PGEQDGREYNFVTKDAFLDLVAKNGFIEHAQFGGNFYGTSVQAVKNIAEKKRICILDIE
FT                   MEGVKQVKRTDLNARFLFLAPPSLEVLEQRLRGRGTETEESLQRRLTQARNELEYANQP
FT                   AAHDKIVVNDDLEKAYAELRDWVVDGGKFGAAQ"
     MASAYRPIVI SGPSGTGKST LLKRLFAEYP DTFGFSISET TRSPRPGEQD GREYNFVTKD        60
     AFLDLVAKNG FIEHAQFGGN FYGTSVQAVK NIAEKKRICI LDIEMEGVKQ VKRTDLNARF       120
     LFLAPPSLEV LEQRLRGRGT ETEESLQRRL TQARNELEYA NQPAAHDKIV VNDDLEKAYA       180
     ELRDWVVDGG KFGAAQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page