(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE185

PENCW_13.PE185       Location/Qualifiers
FT   CDS             join(complement(435949..436087),complement(435759..435887),
FT                   complement(435622..435703),complement(435430..435567),
FT                   complement(435145..435358),complement(434752..435096))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946616"
FT                   /orf_name="Pc16g01850"
FT                   /product="Pc16g01850 protein"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAP92855.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00018316D3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H763"
FT                   /transl_table=1
FT                   /translation="MAAATTAAQAQQPTVFPHSHVGFDSITSQIERKLLKRGFQFNVMC
FT                   VGQTGLGKSTLINTIFASHLIDSKGRLTPSEPVRSTTEIKTESHIIEENGVRLRLNIVD
FT                   TPGYGDQVNNDRCWDPIVKYIKDQHSAYLRKELTAQRERYIQDTRVHCCLFFIQPSGHA
FT                   LKPIDIVVLKKLSDVVNVVPVIAKSDSLTLEERQAFQERIKEEFSFHNLKMYPYDNDEL
FT                   DDEERAINAQIKLQDIIPFSVVGSEKTIVVNGKQVRGRQNRWGVINVEDENHCEFVYLR
FT                   NFLTRTHLQDLVETTSQIHYETFRAKQLLALKESSAAGGHTGGSRPISPSADRELSRNS
FT                   QRAAMNGY"
     MAAATTAAQA QQPTVFPHSH VGFDSITSQI ERKLLKRGFQ FNVMCVGQTG LGKSTLINTI        60
     FASHLIDSKG RLTPSEPVRS TTEIKTESHI IEENGVRLRL NIVDTPGYGD QVNNDRCWDP       120
     IVKYIKDQHS AYLRKELTAQ RERYIQDTRV HCCLFFIQPS GHALKPIDIV VLKKLSDVVN       180
     VVPVIAKSDS LTLEERQAFQ ERIKEEFSFH NLKMYPYDND ELDDEERAIN AQIKLQDIIP       240
     FSVVGSEKTI VVNGKQVRGR QNRWGVINVE DENHCEFVYL RNFLTRTHLQ DLVETTSQIH       300
     YETFRAKQLL ALKESSAAGG HTGGSRPISP SADRELSRNS QRAAMNGY                    348
//

If you have problems or comments...

PBIL Back to PBIL home page