(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE186

PENCW_13.PE186       Location/Qualifiers
FT   CDS             join(436375..436711,436780..436817)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946617"
FT                   /orf_name="Pc16g01860"
FT                   /product="Pc16g01860 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAP92856.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI00018316D4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H764"
FT                   /transl_table=1
FT                   /translation="MALRLLPFAPATMSRSLLSESLQFPRLARFPPITPIATRFLQPVS
FT                   ISLNIPSLLSDLWDSVLRAVPKKKTSHMKKRHRQMAGKALKDVKSLNKCPGCGQIKRAH
FT                   LLCPNCVKDIKESWRTLDMA"
     MALRLLPFAP ATMSRSLLSE SLQFPRLARF PPITPIATRF LQPVSISLNI PSLLSDLWDS        60
     VLRAVPKKKT SHMKKRHRQM AGKALKDVKS LNKCPGCGQI KRAHLLCPNC VKDIKESWRT       120
     LDMA                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page