(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE188

PENCW_13.PE188       Location/Qualifiers
FT   CDS             join(complement(439554..439785),complement(438937..439481))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208946" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824074"
FT                   /orf_name="Pc16g01880"
FT                   /product="Pc16g01880 protein"
FT                   /protein_id="CAP92858.1"
FT                   /db_xref="InterPro:IPR013255"
FT                   /db_xref="UniParc:UPI00018316D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H766"
FT                   /transl_table=1
FT                   /translation="MTSSFEPSLSTSGMRPPLASADAPSMADSLPSINFGFEDLRNSMA
FT                   QFTVKFDAFIERGRKRLLEERNQFHINLAEYEEDERMRQRDIEILNLKSQTHEQTLQKE
FT                   AAEAAEMHAAISSITLERDARLAKRDRLKQQIAETQKAISQKVEAQKSHAQHLDAQSRL
FT                   NFPELEFWQDYLCLRIEGAGREDRLKFVYSHLLEKDWEAEAWFELGTASRDYEVFHTRP
FT                   KVDRDALEHVVDLVNDDRDFGAFLKRMRKLFVETMN"
     MTSSFEPSLS TSGMRPPLAS ADAPSMADSL PSINFGFEDL RNSMAQFTVK FDAFIERGRK        60
     RLLEERNQFH INLAEYEEDE RMRQRDIEIL NLKSQTHEQT LQKEAAEAAE MHAAISSITL       120
     ERDARLAKRD RLKQQIAETQ KAISQKVEAQ KSHAQHLDAQ SRLNFPELEF WQDYLCLRIE       180
     GAGREDRLKF VYSHLLEKDW EAEAWFELGT ASRDYEVFHT RPKVDRDALE HVVDLVNDDR       240
     DFGAFLKRMR KLFVETMN                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page