(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE19

PENCW_13.PE19        Location/Qualifiers
FT   CDS             complement(43746..45080)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945513"
FT                   /orf_name="Pc16g00190"
FT                   /product="Pc16g00190 protein"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP92689.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001831DB1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T0"
FT                   /transl_table=1
FT                   /translation="MSPRFPSENVDVSPLGAPLQFEFSQRKASNRFLKAALTERMASWS
FT                   PADLSARGIPSQNLINLYRRWGEGQFGLILTGNIMIAYDQLESPGNMIIDLENPLSGER
FT                   FEAFKQLATAAKKHGSLIVGQVSHPGRQTFEKLQPNPVSASDVQLVMEKFGAFGKPHAA
FT                   TEEEIQDIIRRFVHVAVYLQKAGYDGIQLHSAHGYLLAQFLSQTTNKRTDKYGGSLANR
FT                   ARIIVEIAQAIRQAVSDPGFIIGIKINSVEFQEHGFTPEESKELCEILDQTNFDFVELS
FT                   GGTYEAGAFQHKRESSQKRESFFLEFADLITPALKRTRSYVTGGFCTASGMVQALKTVD
FT                   GVGLGRTITQEPRLPRELLSGSVKGAIQQKIDPQDFFKTSPAAGAQMLQIAQDEEPIDL
FT                   SCDANMEVFMKSLGEWAQQMQKDGAAMNMYGYAQLPKGQPFQSHL"
     MSPRFPSENV DVSPLGAPLQ FEFSQRKASN RFLKAALTER MASWSPADLS ARGIPSQNLI        60
     NLYRRWGEGQ FGLILTGNIM IAYDQLESPG NMIIDLENPL SGERFEAFKQ LATAAKKHGS       120
     LIVGQVSHPG RQTFEKLQPN PVSASDVQLV MEKFGAFGKP HAATEEEIQD IIRRFVHVAV       180
     YLQKAGYDGI QLHSAHGYLL AQFLSQTTNK RTDKYGGSLA NRARIIVEIA QAIRQAVSDP       240
     GFIIGIKINS VEFQEHGFTP EESKELCEIL DQTNFDFVEL SGGTYEAGAF QHKRESSQKR       300
     ESFFLEFADL ITPALKRTRS YVTGGFCTAS GMVQALKTVD GVGLGRTITQ EPRLPRELLS       360
     GSVKGAIQQK IDPQDFFKTS PAAGAQMLQI AQDEEPIDLS CDANMEVFMK SLGEWAQQMQ       420
     KDGAAMNMYG YAQLPKGQPF QSHL                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page