(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE190

PENCW_13.PE190       Location/Qualifiers
FT   CDS             join(443412..443499,443556..443707)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824075"
FT                   /orf_name="Pc16g01900"
FT                   /product="Pc16g01900 protein"
FT                   /function="metal ion binding"
FT                   /biological_process="metal ion transport"
FT                   /protein_id="CAP92860.1"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="UniParc:UPI00018316D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H796"
FT                   /transl_table=1
FT                   /translation="MSDHQYKFNVTMTCGGCSGAVERVLKKLEGVKTFDVSLETQTVNV
FT                   TTEPTLSYDDVLEKIKKTGKAVNSGEADGESKEV"
     MSDHQYKFNV TMTCGGCSGA VERVLKKLEG VKTFDVSLET QTVNVTTEPT LSYDDVLEKI        60
     KKTGKAVNSG EADGESKEV                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page