(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE191

PENCW_13.PE191       Location/Qualifiers
FT   CDS             join(complement(447050..447184),complement(446878..446997),
FT                   complement(446525..446818),complement(445938..446460),
FT                   complement(444307..445772))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208924" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946619"
FT                   /orf_name="Pc16g01910"
FT                   /product="Pc16g01910 protein"
FT                   /protein_id="CAP92861.1"
FT                   /db_xref="InterPro:IPR018744"
FT                   /db_xref="UniParc:UPI00018316D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H797"
FT                   /transl_table=1
FT                   /translation="MARVTRRAASASARHGAGRAVQRRARRHKVIMESVTQEKKKLRSV
FT                   ICFEAQAPSGYTFIPAGNPQLTTTCKERCRAEGLQIHAVSTTPHHRHHNLSQHVHRIGY
FT                   HFPSTVVAAVCSELGFYLTSTGKTVPSTFPTDRIENSKRADSEVSQITLNTEARDALKD
FT                   LFPNIPDKDLNQIIKTAFQKGQNKVGTATELPLARRVQLAVVAHVRHVYTDYDRLLKTT
FT                   SFHEARGVVEHTTLAKVIEWRGDDENGQTVLEDVFREVIVISDDDDSESEEETADLAGH
FT                   QNTSVEILPSDTRAHEIRSQPINNTNPLGRDLARELSEEAPPGFRFVTRAPATDTINRR
FT                   GFNRYKAWTRAVKEYREASNDSQAHRVPAIPLMDRQVAKRHVGVQENYLHSDVQQKYSA
FT                   HELNARPTGLTNQESPELQILEELSGPRNVNMSHSQDVPPPRMEPRFRQRLPPQSDRTN
FT                   APVFVSGPKDNRQKLTPVGRRPDAGNSPLLRLGSNTQDSILPSIENPRPPENRRTDGAN
FT                   PLVHMANKMSLRSVTPGHPQGEMMPQPDVIEKEGDSGQASKRRRLACREGSRTESRPDP
FT                   WSARPMGLPVSDGFGPPSYRPVELVPDYRAQDQPHFRRDYLPVEPPPVVGYQRESNPNA
FT                   FSYSSAQHGPETRSVLGRQPISGPHEPQSKVGLSGTSIIVSEGDRNFRAAPAVSDSGPW
FT                   HLYHGDRSFRSDCVPKEPRAIRRTRIDGGRPLSENVHSDRNLYAEDFVRHVDHREPPPF
FT                   EYVSRRAGPAAKPIGESSQTARTRDLDYLGTKNLSQTQVSSDQHRPLPIGRVAPSHDHL
FT                   RTFSDPVGKIQPHVSLPQVPRERPASGGFNSSR"
     MARVTRRAAS ASARHGAGRA VQRRARRHKV IMESVTQEKK KLRSVICFEA QAPSGYTFIP        60
     AGNPQLTTTC KERCRAEGLQ IHAVSTTPHH RHHNLSQHVH RIGYHFPSTV VAAVCSELGF       120
     YLTSTGKTVP STFPTDRIEN SKRADSEVSQ ITLNTEARDA LKDLFPNIPD KDLNQIIKTA       180
     FQKGQNKVGT ATELPLARRV QLAVVAHVRH VYTDYDRLLK TTSFHEARGV VEHTTLAKVI       240
     EWRGDDENGQ TVLEDVFREV IVISDDDDSE SEEETADLAG HQNTSVEILP SDTRAHEIRS       300
     QPINNTNPLG RDLARELSEE APPGFRFVTR APATDTINRR GFNRYKAWTR AVKEYREASN       360
     DSQAHRVPAI PLMDRQVAKR HVGVQENYLH SDVQQKYSAH ELNARPTGLT NQESPELQIL       420
     EELSGPRNVN MSHSQDVPPP RMEPRFRQRL PPQSDRTNAP VFVSGPKDNR QKLTPVGRRP       480
     DAGNSPLLRL GSNTQDSILP SIENPRPPEN RRTDGANPLV HMANKMSLRS VTPGHPQGEM       540
     MPQPDVIEKE GDSGQASKRR RLACREGSRT ESRPDPWSAR PMGLPVSDGF GPPSYRPVEL       600
     VPDYRAQDQP HFRRDYLPVE PPPVVGYQRE SNPNAFSYSS AQHGPETRSV LGRQPISGPH       660
     EPQSKVGLSG TSIIVSEGDR NFRAAPAVSD SGPWHLYHGD RSFRSDCVPK EPRAIRRTRI       720
     DGGRPLSENV HSDRNLYAED FVRHVDHREP PPFEYVSRRA GPAAKPIGES SQTARTRDLD       780
     YLGTKNLSQT QVSSDQHRPL PIGRVAPSHD HLRTFSDPVG KIQPHVSLPQ VPRERPASGG       840
     FNSSR                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page