(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE192

PENCW_13.PE192       Location/Qualifiers
FT   CDS             447782..448090
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234764" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671370"
FT                   /orf_name="Pc16g01920"
FT                   /product="Pc16g01920 protein"
FT                   /protein_id="CAP92862.1"
FT                   /db_xref="InterPro:IPR013884"
FT                   /db_xref="UniParc:UPI00018316D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H798"
FT                   /transl_table=1
FT                   /translation="MNASIQAMKVDQRAMIHAYRHLYRQGLKAIQYSTPGRHILLKSLR
FT                   NSYRSSPSEQFDPAKITNTLRFLERATEVAGMEHKILKNLLLARYWEQGHLARESRV"
     MNASIQAMKV DQRAMIHAYR HLYRQGLKAI QYSTPGRHIL LKSLRNSYRS SPSEQFDPAK        60
     ITNTLRFLER ATEVAGMEHK ILKNLLLARY WEQGHLARES RV                          102
//

If you have problems or comments...

PBIL Back to PBIL home page