(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE193

PENCW_13.PE193       Location/Qualifiers
FT   CDS             join(448941..450173,450224..450588,450640..451228)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946620"
FT                   /orf_name="Pc16g01930"
FT                   /product="Pc16g01930 protein"
FT                   /function="electron carrier activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP92863.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00018316DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H799"
FT                   /transl_table=1
FT                   /translation="MSGFISSLLIQIGIRSPLPPQPSKQPNDDQAKFHLNEPTNPSCNS
FT                   EDHKFGPQLDQDHGQKSNCGDAGAGSLHSPPFFTTLPKEMDGRNLQAEGTRSVTDNTPG
FT                   SRNIAATTVGSLDPTYEIDVTAQPDGSGNPQGSHPSEVSNSPSEPQYAASGIAIGEPRR
FT                   SLDNALDPEGLTQSSLPADDGMGVLRSKIIAIRELGLTNVEKARMVHGLMTEGYNSSRE
FT                   LPNTSSPPSLELPTSPRTPRASEINTSRPGSPYTESVPLYESTFNLTTEDLQPTFVPKA
FT                   ETEPPELETGDEDCDTEEQEETILGCVHYQRNVKLECYTCKKWYTCRFCHDEVEDHTLV
FT                   RRDTEHMLCMLCGHAQPAAQNCRQCSEQTAQYYCEICKLWDNDSKKSIYHCSDCGICRI
FT                   GQGLGKDFFHCQTCSVCLPMCIENTHRCIERSTQCDCPICGDYMFTSPETVVVMRCGHS
FT                   IHHKCLSEYSKSSFRCPLCSKTITNMESTFRNLDRTIESQPMPEEFKDTKGLIYCNDCG
FT                   SKSVVKYHWLGLRCDLCESYNTAQLRILHGDMSAQPDEDSGEDLLPRPRSSSVIENDDS
FT                   MSSSLAALNVNNTSVPRSRLSVPMSPEPVRRFSSYNITRGRAVSPVVSNYFGLPTERES
FT                   EKPSSMPFFGGPSRGENEDYGALNFLSKKLTYRYGLFGGETKSVEKVLETGDEEEDDDD
FT                   GESSDSAESDGSHGTEDDEEEEEDQDHIQIFGHQ"
     MSGFISSLLI QIGIRSPLPP QPSKQPNDDQ AKFHLNEPTN PSCNSEDHKF GPQLDQDHGQ        60
     KSNCGDAGAG SLHSPPFFTT LPKEMDGRNL QAEGTRSVTD NTPGSRNIAA TTVGSLDPTY       120
     EIDVTAQPDG SGNPQGSHPS EVSNSPSEPQ YAASGIAIGE PRRSLDNALD PEGLTQSSLP       180
     ADDGMGVLRS KIIAIRELGL TNVEKARMVH GLMTEGYNSS RELPNTSSPP SLELPTSPRT       240
     PRASEINTSR PGSPYTESVP LYESTFNLTT EDLQPTFVPK AETEPPELET GDEDCDTEEQ       300
     EETILGCVHY QRNVKLECYT CKKWYTCRFC HDEVEDHTLV RRDTEHMLCM LCGHAQPAAQ       360
     NCRQCSEQTA QYYCEICKLW DNDSKKSIYH CSDCGICRIG QGLGKDFFHC QTCSVCLPMC       420
     IENTHRCIER STQCDCPICG DYMFTSPETV VVMRCGHSIH HKCLSEYSKS SFRCPLCSKT       480
     ITNMESTFRN LDRTIESQPM PEEFKDTKGL IYCNDCGSKS VVKYHWLGLR CDLCESYNTA       540
     QLRILHGDMS AQPDEDSGED LLPRPRSSSV IENDDSMSSS LAALNVNNTS VPRSRLSVPM       600
     SPEPVRRFSS YNITRGRAVS PVVSNYFGLP TERESEKPSS MPFFGGPSRG ENEDYGALNF       660
     LSKKLTYRYG LFGGETKSVE KVLETGDEEE DDDDGESSDS AESDGSHGTE DDEEEEEDQD       720
     HIQIFGHQ                                                                728
//

If you have problems or comments...

PBIL Back to PBIL home page