(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE194

PENCW_13.PE194       Location/Qualifiers
FT   CDS             join(451260..451519,451567..451702)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946621"
FT                   /orf_name="Pc16g01940"
FT                   /product="Putative uncharacterized protein Pc16g01940 "
FT                   /protein_id="CAP92864.1"
FT                   /db_xref="UniParc:UPI00018316DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A0"
FT                   /transl_table=1
FT                   /translation="MADGLVYRPGECDPAALFLPSSIIPSQAVHRAMNTVQLERSPTPL
FT                   VGFDFRSISDPVPHRVDKNPSRPIPFCTKAISLSLCVPLHMGQPSEGQLNALRGCWSYI
FT                   HQAAGFAAALRSLLFWLSKHTGVMTQR"
     MADGLVYRPG ECDPAALFLP SSIIPSQAVH RAMNTVQLER SPTPLVGFDF RSISDPVPHR        60
     VDKNPSRPIP FCTKAISLSL CVPLHMGQPS EGQLNALRGC WSYIHQAAGF AAALRSLLFW       120
     LSKHTGVMTQ R                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page