(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE195

PENCW_13.PE195       Location/Qualifiers
FT   CDS             453082..453459
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946622"
FT                   /orf_name="Pc16g01950"
FT                   /product="Pc16g01950 protein"
FT                   /protein_id="CAP92865.1"
FT                   /db_xref="UniParc:UPI00018316DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A1"
FT                   /transl_table=1
FT                   /translation="MQIIHGKGEERHFKVTHELSQPYRLYNIVHDPSHLTQITIFDPKV
FT                   PLREETRSQPDQFVAIISENGAKGELDTSHTSPWNRQVASEGNNENVGERKDLCFVPYY
FT                   LRADRGGRGRGQMRVSVLSTE"
     MQIIHGKGEE RHFKVTHELS QPYRLYNIVH DPSHLTQITI FDPKVPLREE TRSQPDQFVA        60
     IISENGAKGE LDTSHTSPWN RQVASEGNNE NVGERKDLCF VPYYLRADRG GRGRGQMRVS       120
     VLSTE                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page