(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE196

PENCW_13.PE196       Location/Qualifiers
FT   CDS             454035..456974
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208902" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824076"
FT                   /orf_name="Pc16g01960"
FT                   /product="Pc16g01960 protein"
FT                   /protein_id="CAP92866.1"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniParc:UPI00018317AA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A2"
FT                   /transl_table=1
FT                   /translation="MIRRNSDIEIQLPDAGPTPLSPESVSDLDVEMLSEESALPLSLPP
FT                   HIAARFYRKSSKARRSSAVSSRRSSVSSLHSHHSNTSSNGSPGADHIAQHLRRTSILES
FT                   RKARLADRALHAEKVRLRAALAKAATRNLQFEERALAAQQARERLLADITAKCEDQVKR
FT                   AKKKAEDQREKKAAEQARLRLEMAEKLAEAEKRRTLYQQTHRRQRTSSLPATEEKKMSR
FT                   EVTKSLTQDAAARKIQRVWRTHNAKMTMQRFQSLNLSVARVRDMTFEEVGALLSNRKLL
FT                   DTMTNVLRLCGLQDMEGGAMGERGAVRTFLSSYLIVTHPKEVLSSDGDQEQDLIAKARE
FT                   LLVAFDQVTALLSSGCCSPSVITADLQTLCESHNVFFSAFHAWKSHDSSVLIEIMVAQF
FT                   VELELIWQTVKNDKAGGAAEDYRLGIRQNQVLLLARLKRLAGPDRHMEMIRDSLKKAKR
FT                   EKKRAAPKQAIPRSAETAPPTTEATQSVTSPLSESFNNIDAAVFQELDKQRTSPHERFT
FT                   KILTPLPENRELVHELLINKEFKIEEAPYTEPRRQIMKQMCDTMRRGVEAGHGTNWTVA
FT                   MATVIQDRLLRSLQRGNSLYVIISEVLDPKLVQGQCEAGTFSYDNFFEFMNNILPRLCA
FT                   PYRDPVVKAYIEDTSGDAIDRLARLMSIIDLLSLDQTNFMIQLAAPQLIEEAPGYEKRA
FT                   FDRDVTDGTISLGKTRRFWRIHRKIIVDEMKKRDPEGVQGEPRPSSARVYAQGLADTVL
FT                   SNAVVSEDLVPETLSLDRQRLERLHAKAFQIVATASILLTAKNLLKRDARSQWKPEADR
FT                   ILSLDFNEISAERVQSILEATHPMPPAASAQLKATIKRVLGPVATACLAAAPQLAVVTS
FT                   ETSASDASVSSTDSPGTTTSAPSFSDPVTKLILSRLRGHVLSRLSASSASERVRATTTA
FT                   SQNLAGAGMPEFVNEVGKLVEELEKVREVDWLCHGAIYEGLYEEGVPAQ"
     MIRRNSDIEI QLPDAGPTPL SPESVSDLDV EMLSEESALP LSLPPHIAAR FYRKSSKARR        60
     SSAVSSRRSS VSSLHSHHSN TSSNGSPGAD HIAQHLRRTS ILESRKARLA DRALHAEKVR       120
     LRAALAKAAT RNLQFEERAL AAQQARERLL ADITAKCEDQ VKRAKKKAED QREKKAAEQA       180
     RLRLEMAEKL AEAEKRRTLY QQTHRRQRTS SLPATEEKKM SREVTKSLTQ DAAARKIQRV       240
     WRTHNAKMTM QRFQSLNLSV ARVRDMTFEE VGALLSNRKL LDTMTNVLRL CGLQDMEGGA       300
     MGERGAVRTF LSSYLIVTHP KEVLSSDGDQ EQDLIAKARE LLVAFDQVTA LLSSGCCSPS       360
     VITADLQTLC ESHNVFFSAF HAWKSHDSSV LIEIMVAQFV ELELIWQTVK NDKAGGAAED       420
     YRLGIRQNQV LLLARLKRLA GPDRHMEMIR DSLKKAKREK KRAAPKQAIP RSAETAPPTT       480
     EATQSVTSPL SESFNNIDAA VFQELDKQRT SPHERFTKIL TPLPENRELV HELLINKEFK       540
     IEEAPYTEPR RQIMKQMCDT MRRGVEAGHG TNWTVAMATV IQDRLLRSLQ RGNSLYVIIS       600
     EVLDPKLVQG QCEAGTFSYD NFFEFMNNIL PRLCAPYRDP VVKAYIEDTS GDAIDRLARL       660
     MSIIDLLSLD QTNFMIQLAA PQLIEEAPGY EKRAFDRDVT DGTISLGKTR RFWRIHRKII       720
     VDEMKKRDPE GVQGEPRPSS ARVYAQGLAD TVLSNAVVSE DLVPETLSLD RQRLERLHAK       780
     AFQIVATASI LLTAKNLLKR DARSQWKPEA DRILSLDFNE ISAERVQSIL EATHPMPPAA       840
     SAQLKATIKR VLGPVATACL AAAPQLAVVT SETSASDASV SSTDSPGTTT SAPSFSDPVT       900
     KLILSRLRGH VLSRLSASSA SERVRATTTA SQNLAGAGMP EFVNEVGKLV EELEKVREVD       960
     WLCHGAIYEG LYEEGVPAQ                                                    979
//

If you have problems or comments...

PBIL Back to PBIL home page