(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE197

PENCW_13.PE197       Location/Qualifiers
FT   CDS             457355..458722
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824077"
FT                   /gene_name="cia1"
FT                   /orf_name="Pc16g01970"
FT                   /product="Probable cytosolic iron-sulfur protein assembly
FT                   protein 1"
FT                   /protein_id="CAP92867.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00018317AB"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6H7A3"
FT                   /transl_table=1
FT                   /translation="MSPKVTITHLSDLTPPSQERTWLTAPHPTLPLVATCSSDKTIRVY
FT                   SLTNFTLLSTITGGHKRSVRTAAWKPHMTGESVLATGSFDATVGIWRRWDSYGQEGDAG
FT                   MGMSSGDKQIPTDISTAASNGTGTDTADREEDEEEWRFAVLLDGHDSEVKSVSWSASGM
FT                   LLATCSRDKSIWIWEDLDDGDNNFETVAVMQEHGGDVKCVSWHPSEECLASGSYDDTIR
FT                   LWREDLDDWGQVACIKGHGGTVWFLDWEGEETEGNWSGPVADSVSESALSALQAQWRSQ
FT                   RALSGPRLLSCSDDRTVRVWRRQPKESQQTGPLSSATTGIPSIIRPTGTDEVWEEDAVL
FT                   PRAHELPVYAVAWSKRTGLVASTGADGRIALYEERFVTREQEQEQQADSDAMDTTSGDV
FT                   LRTEWVLVGVQDGAHGIYEINHVAWAKRADRRPGGEEEVLVSTADDGSVKVWTLTR"
     MSPKVTITHL SDLTPPSQER TWLTAPHPTL PLVATCSSDK TIRVYSLTNF TLLSTITGGH        60
     KRSVRTAAWK PHMTGESVLA TGSFDATVGI WRRWDSYGQE GDAGMGMSSG DKQIPTDIST       120
     AASNGTGTDT ADREEDEEEW RFAVLLDGHD SEVKSVSWSA SGMLLATCSR DKSIWIWEDL       180
     DDGDNNFETV AVMQEHGGDV KCVSWHPSEE CLASGSYDDT IRLWREDLDD WGQVACIKGH       240
     GGTVWFLDWE GEETEGNWSG PVADSVSESA LSALQAQWRS QRALSGPRLL SCSDDRTVRV       300
     WRRQPKESQQ TGPLSSATTG IPSIIRPTGT DEVWEEDAVL PRAHELPVYA VAWSKRTGLV       360
     ASTGADGRIA LYEERFVTRE QEQEQQADSD AMDTTSGDVL RTEWVLVGVQ DGAHGIYEIN       420
     HVAWAKRADR RPGGEEEVLV STADDGSVKV WTLTR                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page