(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE2

PENCW_13.PE2         Location/Qualifiers
FT   CDS             join(1904..2658,2775..3246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977032"
FT                   /orf_name="Pc16g00020"
FT                   /product="Putative uncharacterized protein Pc16g00020 "
FT                   /protein_id="CAP92672.1"
FT                   /db_xref="UniParc:UPI0001831CCC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S1"
FT                   /transl_table=1
FT                   /translation="MPARAHRRAPDPLAGAVNPLPPCRGLSPMAPRGSGLALYAPLPKP
FT                   PGRWPPSTPDPPAVRRTGESVKSPYLPPRRGSSPTPPPKPRLPKPREGAPAPXXXPXAS
FT                   RLALGRPLRAPASPPPHPLHLTRRCGQLPRRANWRPTPPFPGPRSPAGRPSPRGWGRGD
FT                   RRWRTVTWGPACRGVVPRGSPCQGPHRNIPRHPGTPHATRRGHSCGPSLPQPRTVGPGS
FT                   LLHRLTDPIWGVKMQNAVQVAGNCSGGQFLCFGPAFAPPTPILDPAYLPPGPGGALATI
FT                   PAEGACSTVASTKGPASLPAWTGCPLDPRSGPRPTRRANWPIPKGTITPRGRPVYCLSS
FT                   YVPPQLKITALDSPSPPSIPLHPPHHPLHSTAMARNLQPHETHHPQFPFAALRHPPSPS
FT                   PPTTFHRNN"
     MPARAHRRAP DPLAGAVNPL PPCRGLSPMA PRGSGLALYA PLPKPPGRWP PSTPDPPAVR        60
     RTGESVKSPY LPPRRGSSPT PPPKPRLPKP REGAPAPXXX PXASRLALGR PLRAPASPPP       120
     HPLHLTRRCG QLPRRANWRP TPPFPGPRSP AGRPSPRGWG RGDRRWRTVT WGPACRGVVP       180
     RGSPCQGPHR NIPRHPGTPH ATRRGHSCGP SLPQPRTVGP GSLLHRLTDP IWGVKMQNAV       240
     QVAGNCSGGQ FLCFGPAFAP PTPILDPAYL PPGPGGALAT IPAEGACSTV ASTKGPASLP       300
     AWTGCPLDPR SGPRPTRRAN WPIPKGTITP RGRPVYCLSS YVPPQLKITA LDSPSPPSIP       360
     LHPPHHPLHS TAMARNLQPH ETHHPQFPFA ALRHPPSPSP PTTFHRNN                    408
//

If you have problems or comments...

PBIL Back to PBIL home page