(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE200

PENCW_13.PE200       Location/Qualifiers
FT   CDS             join(463363..463398,463446..463529,463596..463988)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208857" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946624"
FT                   /orf_name="Pc16g02000"
FT                   /product="Pc16g02000 protein"
FT                   /protein_id="CAP92870.1"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniParc:UPI00018317AE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A6"
FT                   /transl_table=1
FT                   /translation="MNPHQQNKVDINSLSPEEQRLLRLYGKMPTKKDVLQNKLKERKYF
FT                   DSGDYALSKAGKASDVGVTNIGSRHPVPENIPHLTSTSPGANNSANNGSVSSQGGQQVP
FT                   GSISGHPGSVGFQSRSPIKEGGSYLHHGTSISEGEPGSGPASESVRGEQEFSVSPPPAR
FT                   EGVPIRR"
     MNPHQQNKVD INSLSPEEQR LLRLYGKMPT KKDVLQNKLK ERKYFDSGDY ALSKAGKASD        60
     VGVTNIGSRH PVPENIPHLT STSPGANNSA NNGSVSSQGG QQVPGSISGH PGSVGFQSRS       120
     PIKEGGSYLH HGTSISEGEP GSGPASESVR GEQEFSVSPP PAREGVPIRR                  170
//

If you have problems or comments...

PBIL Back to PBIL home page