(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE201

PENCW_13.PE201       Location/Qualifiers
FT   CDS             join(465399..465923,465979..466782)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128407"
FT                   /orf_name="Pc16g02010"
FT                   /product="Pc16g02010 protein"
FT                   /protein_id="CAP92871.1"
FT                   /db_xref="InterPro:IPR013635"
FT                   /db_xref="UniParc:UPI00018317AF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A7"
FT                   /transl_table=1
FT                   /translation="MWLFRVFSSALFLAITVSSIPLAFDVGGKTCGLAFSLSLAAFYFL
FT                   VSLLKVTTPERSWFRSSIIAVLRFIQWAVILVLLIWSLNRFSVDLDSTGPGWVERTFSG
FT                   KRAEDSSIQEWLFGREGLVETVALGNWDRLLRWSTPVFQLAEGFCSLLVIQAAGQITRW
FT                   LVNRGGRSDSWMIGLLVLSATIISSSVYFLWRVLQFPEISNVDAALIGVSVTCAVILCA
FT                   WGIGSGRGNPVESSLLFAYIVLCIYQIFTDYQPSHPVEQIPSPSQVGDFPPLPPIIMAS
FT                   YTTLMHALSLLPSIIHAAFNVITAVFSAVTPSVLISLAYRLLVLYASTRIIPAVRESGA
FT                   RALSQEASIDDTDAAGQVLGFLSYFAPSILIAVYTSLLMQHFASTSQAMGGSGEWWSTQ
FT                   GNGGGNPWRWINLACTISLYAVELWLGETNDLDNGVAGHWKTD"
     MWLFRVFSSA LFLAITVSSI PLAFDVGGKT CGLAFSLSLA AFYFLVSLLK VTTPERSWFR        60
     SSIIAVLRFI QWAVILVLLI WSLNRFSVDL DSTGPGWVER TFSGKRAEDS SIQEWLFGRE       120
     GLVETVALGN WDRLLRWSTP VFQLAEGFCS LLVIQAAGQI TRWLVNRGGR SDSWMIGLLV       180
     LSATIISSSV YFLWRVLQFP EISNVDAALI GVSVTCAVIL CAWGIGSGRG NPVESSLLFA       240
     YIVLCIYQIF TDYQPSHPVE QIPSPSQVGD FPPLPPIIMA SYTTLMHALS LLPSIIHAAF       300
     NVITAVFSAV TPSVLISLAY RLLVLYASTR IIPAVRESGA RALSQEASID DTDAAGQVLG       360
     FLSYFAPSIL IAVYTSLLMQ HFASTSQAMG GSGEWWSTQG NGGGNPWRWI NLACTISLYA       420
     VELWLGETND LDNGVAGHWK TD                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page