(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE202

PENCW_13.PE202       Location/Qualifiers
FT   CDS             join(468079..468137,468204..469236)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946625"
FT                   /orf_name="Pc16g02020"
FT                   /product="Pc16g02020 protein"
FT                   /protein_id="CAP92872.1"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniParc:UPI00018317B0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H774"
FT                   /transl_table=1
FT                   /translation="MAENVAKKLKTSSPSIGTHNGHFHADEALAVYLLRLLPTYASSPL
FT                   IRTRDPAELEKCHTVVDVGGVYDPAIHRYDHHQRTFSTTFPQRATKLSSAGLVYMHFGK
FT                   AIIAQKLSLPVEHADVDLLYEKLYTDFIEAIDANDNGISAYDQAALTAAGIEKRFKNGG
FT                   ITLASMVGDMNNPDPTSPPGEPQDEDSLFGRASTLIGNAFARKMHHACTSWLPARTTVG
FT                   SAYASRKDVHPSGRIIVLPQGGVPWKEHLYNFEAEASGTKEIDPTVQAYYVLYPENATE
FT                   GAKWRVQCVSVSESSFESRKPLPEAWRGVRDQDLDGVMAAEAEKNGQSKIPEGAVFVHA
FT                   SGFIGGHKTREGAMAMAERSLEL"
     MAENVAKKLK TSSPSIGTHN GHFHADEALA VYLLRLLPTY ASSPLIRTRD PAELEKCHTV        60
     VDVGGVYDPA IHRYDHHQRT FSTTFPQRAT KLSSAGLVYM HFGKAIIAQK LSLPVEHADV       120
     DLLYEKLYTD FIEAIDANDN GISAYDQAAL TAAGIEKRFK NGGITLASMV GDMNNPDPTS       180
     PPGEPQDEDS LFGRASTLIG NAFARKMHHA CTSWLPARTT VGSAYASRKD VHPSGRIIVL       240
     PQGGVPWKEH LYNFEAEASG TKEIDPTVQA YYVLYPENAT EGAKWRVQCV SVSESSFESR       300
     KPLPEAWRGV RDQDLDGVMA AEAEKNGQSK IPEGAVFVHA SGFIGGHKTR EGAMAMAERS       360
     LEL                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page