(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE203

PENCW_13.PE203       Location/Qualifiers
FT   CDS             complement(469824..470393)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671372"
FT                   /orf_name="Pc16g02030"
FT                   /product="Pc16g02030 protein"
FT                   /protein_id="CAP92873.1"
FT                   /db_xref="UniParc:UPI00018317B1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H775"
FT                   /transl_table=1
FT                   /translation="MEHNLLDSLLDVEEQFYNEGYELGTADGAATGYTEGSVFAVEKGF
FT                   EKFVEMGRLYGKALVWAQRLDMKSSEGAAAQADSTTGSTTDTLSLDPSICEDMPSLPPH
FT                   SSRLARNLQTLLELVDPATLDMSNTEEAVNDVDERLKGAATKAKLIQRAMGEREDPAAQ
FT                   VEPKDMSTSGDGSGSIEDISALSIRH"
     MEHNLLDSLL DVEEQFYNEG YELGTADGAA TGYTEGSVFA VEKGFEKFVE MGRLYGKALV        60
     WAQRLDMKSS EGAAAQADST TGSTTDTLSL DPSICEDMPS LPPHSSRLAR NLQTLLELVD       120
     PATLDMSNTE EAVNDVDERL KGAATKAKLI QRAMGEREDP AAQVEPKDMS TSGDGSGSIE       180
     DISALSIRH                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page