(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE207

PENCW_13.PE207       Location/Qualifiers
FT   CDS             join(477336..477486,477537..477588,477642..477825,
FT                   477895..478053)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946628"
FT                   /orf_name="Pc16g02070"
FT                   /product="Pc16g02070 protein"
FT                   /protein_id="CAP92877.1"
FT                   /db_xref="UniParc:UPI00018317B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H779"
FT                   /transl_table=1
FT                   /translation="MSVPLTKIDSAIAGLSISDEKPETTEKEVKAKSHRRTSSTAEGVW
FT                   NIKDLEEQKMDITLPIETQKTGWKLNTSPSTIEDKDILKMFLVNPPVKKIDLHFPLGLE
FT                   VTARNLKGVTVKDALDAIYKQFKKKADDELDKPYLAGFEWDKEDCWTRLIVHQKKEGAP
FT                   QPSKKSKKKSKKKSKDEA"
     MSVPLTKIDS AIAGLSISDE KPETTEKEVK AKSHRRTSST AEGVWNIKDL EEQKMDITLP        60
     IETQKTGWKL NTSPSTIEDK DILKMFLVNP PVKKIDLHFP LGLEVTARNL KGVTVKDALD       120
     AIYKQFKKKA DDELDKPYLA GFEWDKEDCW TRLIVHQKKE GAPQPSKKSK KKSKKKSKDE       180
     A                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page