(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE208

PENCW_13.PE208       Location/Qualifiers
FT   CDS             complement(479140..479646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946629"
FT                   /orf_name="Pc16g02080"
FT                   /product="Pc16g02080 protein"
FT                   /protein_id="CAP92878.1"
FT                   /db_xref="UniParc:UPI00018317B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H780"
FT                   /transl_table=1
FT                   /translation="MAPTPTPAQSHALSIPEIFELILLNLDIRTLLTKASRICHSWSHF
FT                   INSSPRIQWALFFRPLDHALDKPKTQNPLLAETFPSIFDQFECTSKKNDLDTDTTNEKP
FT                   TSNVTLTTFDMIKNPHKWDAYIRPEASWRRMLVQQPPVYTLSLLRSNVGHGGQHLYIYE
FT                   AMVSV"
     MAPTPTPAQS HALSIPEIFE LILLNLDIRT LLTKASRICH SWSHFINSSP RIQWALFFRP        60
     LDHALDKPKT QNPLLAETFP SIFDQFECTS KKNDLDTDTT NEKPTSNVTL TTFDMIKNPH       120
     KWDAYIRPEA SWRRMLVQQP PVYTLSLLRS NVGHGGQHLY IYEAMVSV                    168
//

If you have problems or comments...

PBIL Back to PBIL home page