(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE209

PENCW_13.PE209       Location/Qualifiers
FT   CDS             join(complement(481734..483583),complement(480937..481445),
FT                   complement(479870..480885))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128409"
FT                   /orf_name="Pc16g02090"
FT                   /product="Pc16g02090 protein"
FT                   /function="phosphatidylinositol binding"
FT                   /function="signal transducer activity"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAP92879.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI00018317B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H781"
FT                   /transl_table=1
FT                   /translation="MALSRRDLVLAGVGVFIAWGLVVRWLPILRYLGYAVTLGAILSSV
FT                   GLLGLITLTIRHQNDKANTKNVSVAFIKPNQWRKEVLNVRRSTRYRPRPLYPQSFVVSE
FT                   RIDELLSLITRDFISSWYRSISPNPIFANEVDRTIRVALENLRDRLVAEDMVSLIVSRI
FT                   FPIVTSHLKEFDIAERSVRGRNLNRNVTESGELDLAIANKYRDGRLHPAVATSASDQKA
FT                   VQQDYLRKLAVGLLPQLFPESVLNSRIVSVLIREIISCAVLIPIVTALSDPDTWNQLME
FT                   AYGRTALHDRKTVRKLRAALDQHASPTPKSKRGQPFPRLSATDSERAFERFVRAIRKCN
FT                   NLSDARRFRALVSSQLKQESVVEGQDQVYLKRLETGKRVLDQKVAKLAKPGEDSHVPPA
FT                   LDPRPEIPSKTHESSLVDVMHSASGLSYFMEFMDRQKLMSLVQFWVVVDGFRNPLEDDF
FT                   GDEAAPTSLAWKPADRNDLALISETYLSKPELKVSEESRRAVKTFLSAGKRATPEQYRK
FT                   ARMVVLTTQSAILEHLQDTYYPKFKESDLYWKYLASDEASAAQAPVRQPSPIAVTFEAP
FT                   ERRPLPPLLSRTSSQPGLRPSKDLRRAAVSSGDVRGMGKLFSSEIPQVDNRNERTKKSI
FT                   ASLGLVDHASRLGVFDDDLFPDQQKFIEDEYEEPDGVDEKDSADEVHEAAPGDLGLTEA
FT                   IEALSVDIDKLAAQDAVVQALTRKAELTNNTAELRILRKSKASIQREMHRKEMQRQQYI
FT                   LQESDNSLFGRSTVSIKSIVVGKEEDDGREFAMYVVEVQRNAGEQMPAASWVVARRYSE
FT                   FHDLHQKLRQRYPSVRHLEFPRRRVVMKLQKEFLHKRRLALEAYLQKLLLLPEVCRSRD
FT                   LRAFLSQRAILPRMEIARDNEGETKDLVTRIYNSVADGMDDFLGNFGVLDQLSTAGQNL
FT                   ISAATQQASSAIPESSLATEDAVTAAEAEAELNAFEDRELEPFIKPICDLFLEAFELNR
FT                   GNNWLRGRAVVVVLHQLLGGTIERKVRDGARGLVQDDSLLKYISLARDTLWPGGILRKA
FT                   PPRSAAERLNSRAEATVVLATLIPDLAGNVVGRANAQAAARRIFATLNNQHLNTHLVFT
FT                   ILDEIVLVLFGSAGRPR"
     MALSRRDLVL AGVGVFIAWG LVVRWLPILR YLGYAVTLGA ILSSVGLLGL ITLTIRHQND        60
     KANTKNVSVA FIKPNQWRKE VLNVRRSTRY RPRPLYPQSF VVSERIDELL SLITRDFISS       120
     WYRSISPNPI FANEVDRTIR VALENLRDRL VAEDMVSLIV SRIFPIVTSH LKEFDIAERS       180
     VRGRNLNRNV TESGELDLAI ANKYRDGRLH PAVATSASDQ KAVQQDYLRK LAVGLLPQLF       240
     PESVLNSRIV SVLIREIISC AVLIPIVTAL SDPDTWNQLM EAYGRTALHD RKTVRKLRAA       300
     LDQHASPTPK SKRGQPFPRL SATDSERAFE RFVRAIRKCN NLSDARRFRA LVSSQLKQES       360
     VVEGQDQVYL KRLETGKRVL DQKVAKLAKP GEDSHVPPAL DPRPEIPSKT HESSLVDVMH       420
     SASGLSYFME FMDRQKLMSL VQFWVVVDGF RNPLEDDFGD EAAPTSLAWK PADRNDLALI       480
     SETYLSKPEL KVSEESRRAV KTFLSAGKRA TPEQYRKARM VVLTTQSAIL EHLQDTYYPK       540
     FKESDLYWKY LASDEASAAQ APVRQPSPIA VTFEAPERRP LPPLLSRTSS QPGLRPSKDL       600
     RRAAVSSGDV RGMGKLFSSE IPQVDNRNER TKKSIASLGL VDHASRLGVF DDDLFPDQQK       660
     FIEDEYEEPD GVDEKDSADE VHEAAPGDLG LTEAIEALSV DIDKLAAQDA VVQALTRKAE       720
     LTNNTAELRI LRKSKASIQR EMHRKEMQRQ QYILQESDNS LFGRSTVSIK SIVVGKEEDD       780
     GREFAMYVVE VQRNAGEQMP AASWVVARRY SEFHDLHQKL RQRYPSVRHL EFPRRRVVMK       840
     LQKEFLHKRR LALEAYLQKL LLLPEVCRSR DLRAFLSQRA ILPRMEIARD NEGETKDLVT       900
     RIYNSVADGM DDFLGNFGVL DQLSTAGQNL ISAATQQASS AIPESSLATE DAVTAAEAEA       960
     ELNAFEDREL EPFIKPICDL FLEAFELNRG NNWLRGRAVV VVLHQLLGGT IERKVRDGAR      1020
     GLVQDDSLLK YISLARDTLW PGGILRKAPP RSAAERLNSR AEATVVLATL IPDLAGNVVG      1080
     RANAQAAARR IFATLNNQHL NTHLVFTILD EIVLVLFGSA GRPR                       1124
//

If you have problems or comments...

PBIL Back to PBIL home page