(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE21

PENCW_13.PE21        Location/Qualifiers
FT   CDS             complement(48729..50006)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945514"
FT                   /orf_name="Pc16g00210"
FT                   /product="Pc16g00210 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92691.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="UniParc:UPI0001831DB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S6"
FT                   /transl_table=1
FT                   /translation="MRLLSSLASRPHALSGAVQPARRSHLTWRLYSSTPAAKNRPLPLA
FT                   GVTVVSLEQAIAAPFCTRQLADLGARVIKVERPGVGDFARHYDTRVGGLASHFVWTNRS
FT                   KESLALDLKHEKDHAVLMKLLEKADVLVQNLAPGASARLGLSHEALKGEHPDLIVCDIS
FT                   GYGQDGPYRDKKAYDLLIQNEAGMLSVTGTGKEPVKVGISIADIAAGMYAYSNILSALL
FT                   QRGKDGQGCHIDISMLESMVEWMGFPMYYAFDNAPGPVPAGASHAAIYPYGPFEAGDGQ
FT                   SVMLGIQNEREWVSFCNGVLSQPDLATDPRFSSNSQRTQNRDELKSIIHDAFSKFTTTE
FT                   TIARLDEASIANATVNDMKDVWGHAQLQARDRWTKVQTPVGAIPALLPPGSTNSAGRDG
FT                   HGAQMGSVPRVGEHNEAIFAELGLSN"
     MRLLSSLASR PHALSGAVQP ARRSHLTWRL YSSTPAAKNR PLPLAGVTVV SLEQAIAAPF        60
     CTRQLADLGA RVIKVERPGV GDFARHYDTR VGGLASHFVW TNRSKESLAL DLKHEKDHAV       120
     LMKLLEKADV LVQNLAPGAS ARLGLSHEAL KGEHPDLIVC DISGYGQDGP YRDKKAYDLL       180
     IQNEAGMLSV TGTGKEPVKV GISIADIAAG MYAYSNILSA LLQRGKDGQG CHIDISMLES       240
     MVEWMGFPMY YAFDNAPGPV PAGASHAAIY PYGPFEAGDG QSVMLGIQNE REWVSFCNGV       300
     LSQPDLATDP RFSSNSQRTQ NRDELKSIIH DAFSKFTTTE TIARLDEASI ANATVNDMKD       360
     VWGHAQLQAR DRWTKVQTPV GAIPALLPPG STNSAGRDGH GAQMGSVPRV GEHNEAIFAE       420
     LGLSN                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page