(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE210

PENCW_13.PE210       Location/Qualifiers
FT   CDS             join(484008..484056,484113..484152,484237..484253,
FT                   484310..484736,484787..484844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946630"
FT                   /orf_name="Pc16g02100"
FT                   /product="Pc16g02100 protein"
FT                   /function="N-methyltransferase activity"
FT                   /biological_process="phospholipid metabolic process "
FT                   /protein_id="CAP92880.1"
FT                   /db_xref="GO:0006644"
FT                   /db_xref="GO:0008170"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniParc:UPI00018317B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H782"
FT                   /transl_table=1
FT                   /translation="MASLTDFVDFSSKPLLWSAATIAFNPIFWNIVARAEYRNHFLTRL
FT                   FGGAYNGCYFLAFTIFSLGILRDHLYQLALADQPFYAPVHQPIVGGVLFAIGSVLVLSS
FT                   MWALGVTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLNFLGVALYQGKVAGILLT
FT                   AQVFVLYWFALGWEDPFTAEIYAKRERERAKKQ"
     MASLTDFVDF SSKPLLWSAA TIAFNPIFWN IVARAEYRNH FLTRLFGGAY NGCYFLAFTI        60
     FSLGILRDHL YQLALADQPF YAPVHQPIVG GVLFAIGSVL VLSSMWALGV TGTYLGDYFG       120
     ILMDAPVTGF PFNVTGSPMY WGSTLNFLGV ALYQGKVAGI LLTAQVFVLY WFALGWEDPF       180
     TAEIYAKRER ERAKKQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page