(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE211

PENCW_13.PE211       Location/Qualifiers
FT   CDS             join(487422..487544,487585..487851)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671373"
FT                   /orf_name="Pc16g02110"
FT                   /product="Putative uncharacterized protein Pc16g02110 "
FT                   /protein_id="CAP92881.1"
FT                   /db_xref="UniParc:UPI00018317B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H783"
FT                   /transl_table=1
FT                   /translation="MEILKDENLTVNVTSTETPAHRTHFSAMPGEEIQIPAGIVALQRR
FT                   GGYDLKAVIGTQDEAQTKEQTYDADSKIEGEDEDNTNDKGEERQNQDSGTWTISPCTHC
FT                   LLPKWTCVPYWDGPWTFQLSFYYVD"
     MEILKDENLT VNVTSTETPA HRTHFSAMPG EEIQIPAGIV ALQRRGGYDL KAVIGTQDEA        60
     QTKEQTYDAD SKIEGEDEDN TNDKGEERQN QDSGTWTISP CTHCLLPKWT CVPYWDGPWT       120
     FQLSFYYVD                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page