(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE213

PENCW_13.PE213       Location/Qualifiers
FT   CDS             join(complement(493946..494239),complement(492259..493870),
FT                   complement(492085..492198),complement(491752..492032),
FT                   complement(490267..491715))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671374"
FT                   /orf_name="Pc16g02130"
FT                   /product="Pc16g02130 protein"
FT                   /protein_id="CAP92883.1"
FT                   /db_xref="InterPro:IPR012880"
FT                   /db_xref="InterPro:IPR021773"
FT                   /db_xref="UniParc:UPI0001831889"
FT                   /db_xref="UniProtKB/TrEMBL:B6H784"
FT                   /transl_table=1
FT                   /translation="MDAYPEDYVNHNLPLVLLSGLEADTENEPGTPSDYPLLSEKGTHI
FT                   FSDFPPLSGAVAEELRSLLLEEDSSQSPWKSRVTVSGNTTIANIGYRIKSSGRSCRLPP
FT                   QKADPPIPSPPTTPSDDHDNEHSEPSAHYVLHSPISPLSPGSPTFPDGLLTPLWVTKHQ
FT                   DLVPAAVINFFPFSLDPNMNSLRDNQLKIEINSLKKEWQSSGYKTRFVVVLLSEDGEEG
FT                   GYEGEIDDRIAGIRRATNLDPRSIFVIPPDATSSELQDFVKSLFSLLQPSVVEYYRDLS
FT                   KHARRKRNRGNIPPPTAPPTTGTSQTLSSQGWNVRYEFKLGIFAEFRQEMDAACRNYES
FT                   AYETLFGHEVFENIAGWNPRFNDARLLADALAIRIIRCLLWTGQTTTAARLWVDHRVRV
FT                   KDIVDRRGKGSKHYGWEAWEARWSMVMAQLIRRAEIPPISSEISSEQPRKLYALPEKSI
FT                   PTGERVRPWEHLHHEGYWLHRSAKHTMLRRALAQEIPLEDRKPPGQSPASQLANKSYLY
FT                   DTYLVPDAHAEAPQEGRTGFDHSGLILSTLKAAIEEFAKRDQTRKVESLSLEAAEEYMR
FT                   IGSWSEAHGLLRPLWSTLSWRRSGWWHLMANFGRALRECALRMQDSETILRVDWELLNK
FT                   NLKPRSAWHYDIHKSLESLPSEKPKPSLILRAEDVITSLTASLVFEKSDGNVGEPLHAQ
FT                   LAITSCAHKFSAPIRLSEVKLVFEGCLRPVKVQSDQNQDADTTTSCCIATLPLREPSNA
FT                   DTAVQSPAGGLTALTKVFDLTCVPREAGEARVASITMLIEEEQFDLGYAVTEPEQRESF
FT                   WWEQTQKGVTRRRVGKDRDTGRCKVMPKPPKIRLTTPNLKRTYYTNERVMLQIGIHNEE
FT                   DEAADISAEIRLFGTESAAQIQWLDGDSNPELLESGASTPIEGPSHYLKRSVGVLERSS
FT                   QKTLTIVLVDTQEATDFTLEVSTVYHLVSDTQTPIMKNTTVDLSFIRPFEANYEFLPAI
FT                   HPQPWPNFFAVSDNLLEDGSAPSPGGLFQKWYLNSKVVSFALEPLVIDKMSLVLLEANG
FT                   GVVCDVHSEELVTPGTPHLAPEELRESNFCLDVQKLLLGDRRPTALTCTLEINWRRQSS
FT                   ESVASSDAENSVTTTVLDIPRFVVPMGEPRVLASATPSSSMAGLIHMGYVLENPSTHFL
FT                   TFNLVMEASEHFAFSGPKTTVVQLVPLSRHTVNFNLFAAKRGLWIQPQLVVIDTYFNKT
FT                   LRVLPTGDMRSDKKGVLVWVDADD"
     MDAYPEDYVN HNLPLVLLSG LEADTENEPG TPSDYPLLSE KGTHIFSDFP PLSGAVAEEL        60
     RSLLLEEDSS QSPWKSRVTV SGNTTIANIG YRIKSSGRSC RLPPQKADPP IPSPPTTPSD       120
     DHDNEHSEPS AHYVLHSPIS PLSPGSPTFP DGLLTPLWVT KHQDLVPAAV INFFPFSLDP       180
     NMNSLRDNQL KIEINSLKKE WQSSGYKTRF VVVLLSEDGE EGGYEGEIDD RIAGIRRATN       240
     LDPRSIFVIP PDATSSELQD FVKSLFSLLQ PSVVEYYRDL SKHARRKRNR GNIPPPTAPP       300
     TTGTSQTLSS QGWNVRYEFK LGIFAEFRQE MDAACRNYES AYETLFGHEV FENIAGWNPR       360
     FNDARLLADA LAIRIIRCLL WTGQTTTAAR LWVDHRVRVK DIVDRRGKGS KHYGWEAWEA       420
     RWSMVMAQLI RRAEIPPISS EISSEQPRKL YALPEKSIPT GERVRPWEHL HHEGYWLHRS       480
     AKHTMLRRAL AQEIPLEDRK PPGQSPASQL ANKSYLYDTY LVPDAHAEAP QEGRTGFDHS       540
     GLILSTLKAA IEEFAKRDQT RKVESLSLEA AEEYMRIGSW SEAHGLLRPL WSTLSWRRSG       600
     WWHLMANFGR ALRECALRMQ DSETILRVDW ELLNKNLKPR SAWHYDIHKS LESLPSEKPK       660
     PSLILRAEDV ITSLTASLVF EKSDGNVGEP LHAQLAITSC AHKFSAPIRL SEVKLVFEGC       720
     LRPVKVQSDQ NQDADTTTSC CIATLPLREP SNADTAVQSP AGGLTALTKV FDLTCVPREA       780
     GEARVASITM LIEEEQFDLG YAVTEPEQRE SFWWEQTQKG VTRRRVGKDR DTGRCKVMPK       840
     PPKIRLTTPN LKRTYYTNER VMLQIGIHNE EDEAADISAE IRLFGTESAA QIQWLDGDSN       900
     PELLESGAST PIEGPSHYLK RSVGVLERSS QKTLTIVLVD TQEATDFTLE VSTVYHLVSD       960
     TQTPIMKNTT VDLSFIRPFE ANYEFLPAIH PQPWPNFFAV SDNLLEDGSA PSPGGLFQKW      1020
     YLNSKVVSFA LEPLVIDKMS LVLLEANGGV VCDVHSEELV TPGTPHLAPE ELRESNFCLD      1080
     VQKLLLGDRR PTALTCTLEI NWRRQSSESV ASSDAENSVT TTVLDIPRFV VPMGEPRVLA      1140
     SATPSSSMAG LIHMGYVLEN PSTHFLTFNL VMEASEHFAF SGPKTTVVQL VPLSRHTVNF      1200
     NLFAAKRGLW IQPQLVVIDT YFNKTLRVLP TGDMRSDKKG VLVWVDADD                  1249
//

If you have problems or comments...

PBIL Back to PBIL home page