(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE214

PENCW_13.PE214       Location/Qualifiers
FT   CDS             join(495350..497147,497196..498124)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824078"
FT                   /orf_name="Pc16g02140"
FT                   /product="Pc16g02140 protein"
FT                   /protein_id="CAP92884.1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000183188A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H785"
FT                   /transl_table=1
FT                   /translation="MSNENPVQAESALLSRRRRRKSLPSRNGTDPTSPEVISSLISSLS
FT                   TISVPLNSHFDTIPKIDNESDPGLPEVPHTAPVYSIPPSEQHGFGMSYGAYKPTVEPPA
FT                   LPENPFLHPDDAASSPVIRMARAPPSPKSPRSPRFKPFRTADSSSTRPASRESYTSVIA
FT                   APEPSSFGTISTEPGPRLSTPSIASNSSAGRTKSLKGQLSLLKRSSREFVGEKDPQIER
FT                   LRKTTSYNDSLRHNVPRSRASLRSLHSMAEVTEEARPADVKEEPYEEKVASTPTKDYQS
FT                   FHGTPDASNPGGIGSGRIIPTRDSSLRHRHSQSSSSKKHRSARHSRYSSTASKEFNTDN
FT                   GLPGTSNDAEQVTRRIQEVKDQQQKIKTELEVGNSPEHSTKASPAKQAKPSKVSRVLGY
FT                   DVNQAMQNGPRRDRPSFNESAPSPNVMTGKSRTGSRPGAPLAPKSTHLPSQLPKSSVER
FT                   PDSERARYRQSLEPITPITHRRTPSGHLSHLSNGRPSYSTERPSSADSIDLAVDDYIFS
FT                   PKLTQRVIHPTTGRSIAFSEVGNPKGHVVLCCVGMGLTRYLMAFYDELARTLNLRLVTL
FT                   DRPGVGESGPHQGDEPSTPLSWPDDVAIVCNHLRVTKFSILAHSAGAIYALATALRIPQ
FT                   HIRGRIHLLAPWIPPSQLSNIGSKKEPAPTNAVPYSQKILRALPTSLLKVANSSFMSAT
FT                   SASITTSLPKSPRRAKRKAATKEASNATAIPPVPPIPSVDPNPQTPRVDIVPNIKPSAS
FT                   NTASYRKSDATLGSRAKSPEDEVERQRDYDTRLTYKIWELATTNANPAVDLLTCLERRQ
FT                   TIGFRYVDITRSVVIHHGSKDPRVPAENVQWLGKTMRRCEVRILEGEGHGLMASAGVMG
FT                   NVLTEIAKEWEDWTILVQGKRRATVSHAARPGLSIQT"
     MSNENPVQAE SALLSRRRRR KSLPSRNGTD PTSPEVISSL ISSLSTISVP LNSHFDTIPK        60
     IDNESDPGLP EVPHTAPVYS IPPSEQHGFG MSYGAYKPTV EPPALPENPF LHPDDAASSP       120
     VIRMARAPPS PKSPRSPRFK PFRTADSSST RPASRESYTS VIAAPEPSSF GTISTEPGPR       180
     LSTPSIASNS SAGRTKSLKG QLSLLKRSSR EFVGEKDPQI ERLRKTTSYN DSLRHNVPRS       240
     RASLRSLHSM AEVTEEARPA DVKEEPYEEK VASTPTKDYQ SFHGTPDASN PGGIGSGRII       300
     PTRDSSLRHR HSQSSSSKKH RSARHSRYSS TASKEFNTDN GLPGTSNDAE QVTRRIQEVK       360
     DQQQKIKTEL EVGNSPEHST KASPAKQAKP SKVSRVLGYD VNQAMQNGPR RDRPSFNESA       420
     PSPNVMTGKS RTGSRPGAPL APKSTHLPSQ LPKSSVERPD SERARYRQSL EPITPITHRR       480
     TPSGHLSHLS NGRPSYSTER PSSADSIDLA VDDYIFSPKL TQRVIHPTTG RSIAFSEVGN       540
     PKGHVVLCCV GMGLTRYLMA FYDELARTLN LRLVTLDRPG VGESGPHQGD EPSTPLSWPD       600
     DVAIVCNHLR VTKFSILAHS AGAIYALATA LRIPQHIRGR IHLLAPWIPP SQLSNIGSKK       660
     EPAPTNAVPY SQKILRALPT SLLKVANSSF MSATSASITT SLPKSPRRAK RKAATKEASN       720
     ATAIPPVPPI PSVDPNPQTP RVDIVPNIKP SASNTASYRK SDATLGSRAK SPEDEVERQR       780
     DYDTRLTYKI WELATTNANP AVDLLTCLER RQTIGFRYVD ITRSVVIHHG SKDPRVPAEN       840
     VQWLGKTMRR CEVRILEGEG HGLMASAGVM GNVLTEIAKE WEDWTILVQG KRRATVSHAA       900
     RPGLSIQT                                                                908
//

If you have problems or comments...

PBIL Back to PBIL home page