(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE215

PENCW_13.PE215       Location/Qualifiers
FT   CDS             join(498906..498983,499054..499477,499545..499861)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208731" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946631"
FT                   /orf_name="Pc16g02150"
FT                   /product="Pc16g02150 protein"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAP92885.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI000183188B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H786"
FT                   /transl_table=1
FT                   /translation="MPSSQRRLRLVVIAVIALLFMVFYYTGDATKIQNQKFYRSTIDAM
FT                   KAKEQAKQAKAQEKIQHPVHAPGQNVAAGAGAGEKVPVAEVEKAAVPPATDNEDTEEVS
FT                   IAGRTKMTVPKKANQDTPSEVQSELKSEEEKEREEKAKREREEKERKEAEATTELNAIL
FT                   KRAPVIVFSKSYCPYSKKAKLILLEHYSIEPKPLVVELDQHPLGPYLQALLAQSTGRRT
FT                   VPNVLVSGKSIGGGDDIAALDQRDELASTLRQMGGKWIVDVSHHEVEKSL"
     MPSSQRRLRL VVIAVIALLF MVFYYTGDAT KIQNQKFYRS TIDAMKAKEQ AKQAKAQEKI        60
     QHPVHAPGQN VAAGAGAGEK VPVAEVEKAA VPPATDNEDT EEVSIAGRTK MTVPKKANQD       120
     TPSEVQSELK SEEEKEREEK AKREREEKER KEAEATTELN AILKRAPVIV FSKSYCPYSK       180
     KAKLILLEHY SIEPKPLVVE LDQHPLGPYL QALLAQSTGR RTVPNVLVSG KSIGGGDDIA       240
     ALDQRDELAS TLRQMGGKWI VDVSHHEVEK SL                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page