(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE216

PENCW_13.PE216       Location/Qualifiers
FT   CDS             join(500252..500297,500563..500866,500965..501142,
FT                   501214..501264)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000039905" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128410"
FT                   /orf_name="Pc16g02160"
FT                   /product="Pc16g02160 protein"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP92886.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniParc:UPI000183188C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H787"
FT                   /transl_table=1
FT                   /translation="MRYIHSEERLPILDNVKVHIKSRIVTVEGPRGKLVKDLSHIAVTF
FT                   GRPEQNVISIELHHGARKGVATLRTVRTIINNLMIGVTRGFKYKMRYVYAHFPINVNIE
FT                   PNPETGRAVVEIRNFLGEKYVRRITAQPDVDIAPSANVKDELVLTGNSLEGVSQSAADI
FT                   QQVCRVRNKDIRKFLDGLYVSEKGNIIEE"
     MRYIHSEERL PILDNVKVHI KSRIVTVEGP RGKLVKDLSH IAVTFGRPEQ NVISIELHHG        60
     ARKGVATLRT VRTIINNLMI GVTRGFKYKM RYVYAHFPIN VNIEPNPETG RAVVEIRNFL       120
     GEKYVRRITA QPDVDIAPSA NVKDELVLTG NSLEGVSQSA ADIQQVCRVR NKDIRKFLDG       180
     LYVSEKGNII EE                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page