(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE218

PENCW_13.PE218       Location/Qualifiers
FT   CDS             join(complement(504639..504812),complement(504304..504405),
FT                   complement(504114..504200))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128411"
FT                   /orf_name="Pc16g02180"
FT                   /product="Putative uncharacterized protein Pc16g02180 "
FT                   /protein_id="CAP92888.1"
FT                   /db_xref="UniParc:UPI000183188E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H789"
FT                   /transl_table=1
FT                   /translation="MSLLDDGWTVVERHKNARVRNKIAAENVKFIGHSIKELEGCWVVA
FT                   VNTFFARGGGAEQDERLVLTFIVTAVTGEQRKCHVFETGKGTRCVGDEVLDIKLKSMRV
FT                   ILKPNPNLQDIGIIPR"
     MSLLDDGWTV VERHKNARVR NKIAAENVKF IGHSIKELEG CWVVAVNTFF ARGGGAEQDE        60
     RLVLTFIVTA VTGEQRKCHV FETGKGTRCV GDEVLDIKLK SMRVILKPNP NLQDIGIIPR       120
//

If you have problems or comments...

PBIL Back to PBIL home page