(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE221

PENCW_13.PE221       Location/Qualifiers
FT   CDS             join(complement(511271..512759),complement(511175..511212))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946634"
FT                   /orf_name="Pc16g02210"
FT                   /product="Pc16g02210 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92891.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001831891"
FT                   /db_xref="UniProtKB/TrEMBL:B6H792"
FT                   /transl_table=1
FT                   /translation="MALEKEISPSPSPQDHEKGTIENLQLDRLGYKQELRRNRSVLTLL
FT                   FQTLAMAAIPYGEGSPLLSAIYGGGPLSIFIGWIVVCLLDQCIALSLAELSSRYPTSAG
FT                   PYYWTFQISRKKTTLSFINAWIWLIGNWTITLSVNFGFASMLSATISIYHPTWSASSWQ
FT                   LLLIFYAVCLTSLAICIFANNHLPLVDTLCATWTLLTIIIILVALSIKADTGRHSVSYT
FT                   LSHYDKSFAGWGDFTFFIGLLPAAYTFSAIGMISSMAEECANPAIKVPRAIALSIPVGG
FT                   TAGLFFIIPICATLPPLQDIIDAPAGQALPYILARVMGSPAGGLGLVSLVLVITVFCSI
FT                   SITVAASRATWAVARDDAVPLARLWARVDQRWGVPVWALVLLTGIQMLLGLINLGSSSA
FT                   FTAFVSVGVIALATAYAIPIFLSLWYGRREVAKAPWNCGGVGWFVNVVALAWIAFELVL
FT                   FSMPMALPVTAVSMNYASVVFVGFMAISAVWYGVYARKYYKGPPESDALD"
     MALEKEISPS PSPQDHEKGT IENLQLDRLG YKQELRRNRS VLTLLFQTLA MAAIPYGEGS        60
     PLLSAIYGGG PLSIFIGWIV VCLLDQCIAL SLAELSSRYP TSAGPYYWTF QISRKKTTLS       120
     FINAWIWLIG NWTITLSVNF GFASMLSATI SIYHPTWSAS SWQLLLIFYA VCLTSLAICI       180
     FANNHLPLVD TLCATWTLLT IIIILVALSI KADTGRHSVS YTLSHYDKSF AGWGDFTFFI       240
     GLLPAAYTFS AIGMISSMAE ECANPAIKVP RAIALSIPVG GTAGLFFIIP ICATLPPLQD       300
     IIDAPAGQAL PYILARVMGS PAGGLGLVSL VLVITVFCSI SITVAASRAT WAVARDDAVP       360
     LARLWARVDQ RWGVPVWALV LLTGIQMLLG LINLGSSSAF TAFVSVGVIA LATAYAIPIF       420
     LSLWYGRREV AKAPWNCGGV GWFVNVVALA WIAFELVLFS MPMALPVTAV SMNYASVVFV       480
     GFMAISAVWY GVYARKYYKG PPESDALD                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page