(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE222

PENCW_13.PE222       Location/Qualifiers
FT   CDS             complement(513516..515699)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946635"
FT                   /orf_name="Pc16g02220"
FT                   /product="Pc16g02220 protein"
FT                   /protein_id="CAP92892.1"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="UniParc:UPI0001831892"
FT                   /db_xref="UniProtKB/TrEMBL:B6H793"
FT                   /transl_table=1
FT                   /translation="MGNPALDLKVAQTNQSMVAIAGIPQNGETGQYIARGSNDRFELIS
FT                   GPLLNLKNMHYEATTTWHGSVLIVTKPTQDNPQLRLRQVGAVDSGAQNGEGRAPTSQTI
FT                   EGLKLYEDPQKAFWRFSLTVPVAAFEARWAYDIPGLYESGAQVQTSWEFVVPAEEQSMR
FT                   IMFHSCNGFSVGTDMDAWVGPNLWNDVMRVHGEKPFHVMVGGGDQIYNDGIRVDGPLKP
FT                   WTMISNPHKRRHHDFNNQMRAESDDYYYANYVRWYNTEPFRAANGRIPQVNIWDDHDII
FT                   DGFGSYTDHFMKCAVFRGIGGVAFKYYCLFQHHIAPPKSTFTTDSPQTMHAVNGTSGVD
FT                   PRQVENTYVLENQVEDDSWIIGKRPGPYVEERSRNLYMRFGKRIAFMGLDARTERTRHQ
FT                   VNYEDTYDLIFDRLQREIVDSNGDIKHLVVLLGVPIAYPRLAWLENILTSPLIAPVRLL
FT                   NKRFGVAGGLFNEFDGQVDLLDDLDDHYTARQHKRERKMLVHRLQEFARSHSVRVTILS
FT                   GDVHLAAIGRFYSNPKLNLSGENDHRFIVNVVSSAITNKPPPQAVANLLARRNKIHHLD
FT                   RECDETLMPIFDKQPGGREKGADWNKVTMPSRNFAILTEVVAPGAGNTGILDANSVKLD
FT                   RLPKDGHAPLHKGEVDAGTTHGAADGFTCATGMYGGLDVSVRVEIDPHDRSATTEGYGF
FT                   SIPPLLATEGPPSTGHRLSLHSRRSQGRPSTAM"
     MGNPALDLKV AQTNQSMVAI AGIPQNGETG QYIARGSNDR FELISGPLLN LKNMHYEATT        60
     TWHGSVLIVT KPTQDNPQLR LRQVGAVDSG AQNGEGRAPT SQTIEGLKLY EDPQKAFWRF       120
     SLTVPVAAFE ARWAYDIPGL YESGAQVQTS WEFVVPAEEQ SMRIMFHSCN GFSVGTDMDA       180
     WVGPNLWNDV MRVHGEKPFH VMVGGGDQIY NDGIRVDGPL KPWTMISNPH KRRHHDFNNQ       240
     MRAESDDYYY ANYVRWYNTE PFRAANGRIP QVNIWDDHDI IDGFGSYTDH FMKCAVFRGI       300
     GGVAFKYYCL FQHHIAPPKS TFTTDSPQTM HAVNGTSGVD PRQVENTYVL ENQVEDDSWI       360
     IGKRPGPYVE ERSRNLYMRF GKRIAFMGLD ARTERTRHQV NYEDTYDLIF DRLQREIVDS       420
     NGDIKHLVVL LGVPIAYPRL AWLENILTSP LIAPVRLLNK RFGVAGGLFN EFDGQVDLLD       480
     DLDDHYTARQ HKRERKMLVH RLQEFARSHS VRVTILSGDV HLAAIGRFYS NPKLNLSGEN       540
     DHRFIVNVVS SAITNKPPPQ AVANLLARRN KIHHLDRECD ETLMPIFDKQ PGGREKGADW       600
     NKVTMPSRNF AILTEVVAPG AGNTGILDAN SVKLDRLPKD GHAPLHKGEV DAGTTHGAAD       660
     GFTCATGMYG GLDVSVRVEI DPHDRSATTE GYGFSIPPLL ATEGPPSTGH RLSLHSRRSQ       720
     GRPSTAM                                                                 727
//

If you have problems or comments...

PBIL Back to PBIL home page