(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE223

PENCW_13.PE223       Location/Qualifiers
FT   CDS             join(complement(516550..517542),complement(516401..516419),
FT                   complement(516291..516316),complement(515918..516247))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824079"
FT                   /orf_name="Pc16g02230"
FT                   /product="Pc16g02230 protein"
FT                   /protein_id="CAP92893.1"
FT                   /db_xref="UniParc:UPI0001831893"
FT                   /db_xref="UniProtKB/TrEMBL:B6H794"
FT                   /transl_table=1
FT                   /translation="MQSPRLSPSADDMIPVNPLKRVKPTKSTNPNPPKDPQPVTKELSF
FT                   ASYLNRYMRHPWGVIDYHIYLTHIESGRDKLRREKECHLLETTGFAQVTLHDEPVLNNI
FT                   PAYTNPTVFFVSLPVPDIQNESSNALLVLGFDLQSDRLQGYFFEPESPVENYDDLWEVW
FT                   SQGEGHLVIDVPVDRFLAIIRHTMQHRIEILEIGVLHHYGLTTREFQAGLDMVVTVQFL
FT                   QFVDDFAELLSEEPDELRETYTPFQDELRELLASGSRDAWFAVRDGLNIEQYRQKQLKK
FT                   VVSSGLFQGQDVLVLRDGSEEITEKDKSRPVKIVPGHRRWSWSKLRVRVLLFRSIEIKS
FT                   PGVHDSGLYMYKCPKQDNSSIQIAIKICEIHENPRKSDRQKKKCTASLAQSGIARNHSC
FT                   GVTWLNWGVAGITFSPIGQTINGMSWQRQSCSSSFLGPRPQGPKGTDPQPPISLRV"
     MQSPRLSPSA DDMIPVNPLK RVKPTKSTNP NPPKDPQPVT KELSFASYLN RYMRHPWGVI        60
     DYHIYLTHIE SGRDKLRREK ECHLLETTGF AQVTLHDEPV LNNIPAYTNP TVFFVSLPVP       120
     DIQNESSNAL LVLGFDLQSD RLQGYFFEPE SPVENYDDLW EVWSQGEGHL VIDVPVDRFL       180
     AIIRHTMQHR IEILEIGVLH HYGLTTREFQ AGLDMVVTVQ FLQFVDDFAE LLSEEPDELR       240
     ETYTPFQDEL RELLASGSRD AWFAVRDGLN IEQYRQKQLK KVVSSGLFQG QDVLVLRDGS       300
     EEITEKDKSR PVKIVPGHRR WSWSKLRVRV LLFRSIEIKS PGVHDSGLYM YKCPKQDNSS       360
     IQIAIKICEI HENPRKSDRQ KKKCTASLAQ SGIARNHSCG VTWLNWGVAG ITFSPIGQTI       420
     NGMSWQRQSC SSSFLGPRPQ GPKGTDPQPP ISLRV                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page