(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE224

PENCW_13.PE224       Location/Qualifiers
FT   CDS             518856..519248
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946636"
FT                   /orf_name="Pc16g02240"
FT                   /product="Putative uncharacterized protein Pc16g02240 "
FT                   /protein_id="CAP92894.1"
FT                   /db_xref="UniParc:UPI0001831894"
FT                   /db_xref="UniProtKB/TrEMBL:B6H795"
FT                   /transl_table=1
FT                   /translation="MGQDSVFIVQAEYFQDFDGDAWVSVDSHDFDDPDNEEADWVTVVL
FT                   PEEMAHTHDDEDIMMYVLHNIQTRRAVVREVALHNMGTVCISIPIPVGTADTTSILVQA
FT                   ETDVKKWLEHIRDGMVTLDREVIFGR"
     MGQDSVFIVQ AEYFQDFDGD AWVSVDSHDF DDPDNEEADW VTVVLPEEMA HTHDDEDIMM        60
     YVLHNIQTRR AVVREVALHN MGTVCISIPI PVGTADTTSI LVQAETDVKK WLEHIRDGMV       120
     TLDREVIFGR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page