(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE225

PENCW_13.PE225       Location/Qualifiers
FT   CDS             join(complement(519962..520459),complement(519567..519621),
FT                   complement(519452..519530),complement(519294..519384))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946637"
FT                   /orf_name="Pc16g02250"
FT                   /product="Putative uncharacterized protein Pc16g02250 "
FT                   /protein_id="CAP92895.1"
FT                   /db_xref="UniParc:UPI0001831895"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A8"
FT                   /transl_table=1
FT                   /translation="MNKGKMPIYQGHSSSLSSEPPQLCSNPLTNLPSQFQPSVYKFTSG
FT                   QYFAEPAGHRSDYYWVTVYFPKDIDHRDIQDSEVMLYVKDMIVKGRFTIDDQSMHGLGG
FT                   KCLSIPIKRDPDTPLPKSYTPDPTHPDLLLAENLAAYWKDQIAFKKVTLDRRMIFVETR
FT                   RKTRVPAILGGIVTVFLSIFFDTWMDIWPYTYMNIYVHVLDTRELAMRFDIPTLTQFSD
FT                   STRQPIAQSLDNPFVLEI"
     MNKGKMPIYQ GHSSSLSSEP PQLCSNPLTN LPSQFQPSVY KFTSGQYFAE PAGHRSDYYW        60
     VTVYFPKDID HRDIQDSEVM LYVKDMIVKG RFTIDDQSMH GLGGKCLSIP IKRDPDTPLP       120
     KSYTPDPTHP DLLLAENLAA YWKDQIAFKK VTLDRRMIFV ETRRKTRVPA ILGGIVTVFL       180
     SIFFDTWMDI WPYTYMNIYV HVLDTRELAM RFDIPTLTQF SDSTRQPIAQ SLDNPFVLEI       240
//

If you have problems or comments...

PBIL Back to PBIL home page