(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE226

PENCW_13.PE226       Location/Qualifiers
FT   CDS             join(521064..521205,521248..521552)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977311"
FT                   /orf_name="Pc16g02260"
FT                   /product="Putative uncharacterized protein Pc16g02260 "
FT                   /protein_id="CAP92896.1"
FT                   /db_xref="UniParc:UPI0001831896"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7A9"
FT                   /transl_table=1
FT                   /translation="MPFFQASVFQSTQPDHDRRFHFKDPHNSQPGWVWGTVALPDTIGV
FT                   ATAGLVSWGDRATHGLGNYCISFPIKVETPEQNLERLTDQVQDAAMWWLRLVRDKSVSI
FT                   DKHMLFQARQPPPDRDDQLLDAPLHWERPKYTVPNPWSAVTVLQ"
     MPFFQASVFQ STQPDHDRRF HFKDPHNSQP GWVWGTVALP DTIGVATAGL VSWGDRATHG        60
     LGNYCISFPI KVETPEQNLE RLTDQVQDAA MWWLRLVRDK SVSIDKHMLF QARQPPPDRD       120
     DQLLDAPLHW ERPKYTVPNP WSAVTVLQ                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page