(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE227

PENCW_13.PE227       Location/Qualifiers
FT   CDS             join(complement(522919..523762),complement(522760..522863),
FT                   complement(522369..522702),complement(522128..522302),
FT                   complement(521795..522065))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208687" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946638"
FT                   /orf_name="Pc16g02270"
FT                   /product="Pc16g02270 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92897.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI000183195D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B0"
FT                   /transl_table=1
FT                   /translation="MSNVVWAVWRAPCPGLRTSVLPVPFRAASRDLRITPWRMYSTSRQ
FT                   SMLPIPNLLSQLLARPSRPTPTPISPQRFNPVSTPRRFKRTSAASQKPKPKSDPSEVHP
FT                   RQKPFSDAEIKAIFGPAKFNAKLGNRILAVLHGHRLSGTLDADLPVDIARAVTKQQVDA
FT                   ALEWLRDEYPLDEDAAIFARIEREDRAAEEKLVRRAEKLGLYKPQSGSYDAELGEEGSP
FT                   YGKSVLKEARERNEKRLLAEQERKRQEWLDGEKEEQERLKREFGKNTSLQEYQEAALTE
FT                   ARPRADPIERPYLAWVQKHHIAATNDSPESMNITNSQRLLAPLLFSIVVLALCYTFAQK
FT                   YEFPARKDRIMPDVPPAVATVGAIVAANVAVTLLWKYIPPAWKLLNRYFVIVPFYPSSL
FT                   GMIGSTFSHQTWRHLGTNMMVLGLMGTRVHDEIGRGNFLAIYFASGVMGSVFSLTRSVI
FT                   LGRLGMTSLGASAATSGIVAAWCMSHFNDKLTMWILPQGLQDQIWTYGWVFLTCLVGTE
FT                   VFSLIAPAFLFRAWPLSRLTKMDHAAHLGGYATGAGCGYTLMQKRKERERKARQSRWF"
     MSNVVWAVWR APCPGLRTSV LPVPFRAASR DLRITPWRMY STSRQSMLPI PNLLSQLLAR        60
     PSRPTPTPIS PQRFNPVSTP RRFKRTSAAS QKPKPKSDPS EVHPRQKPFS DAEIKAIFGP       120
     AKFNAKLGNR ILAVLHGHRL SGTLDADLPV DIARAVTKQQ VDAALEWLRD EYPLDEDAAI       180
     FARIEREDRA AEEKLVRRAE KLGLYKPQSG SYDAELGEEG SPYGKSVLKE ARERNEKRLL       240
     AEQERKRQEW LDGEKEEQER LKREFGKNTS LQEYQEAALT EARPRADPIE RPYLAWVQKH       300
     HIAATNDSPE SMNITNSQRL LAPLLFSIVV LALCYTFAQK YEFPARKDRI MPDVPPAVAT       360
     VGAIVAANVA VTLLWKYIPP AWKLLNRYFV IVPFYPSSLG MIGSTFSHQT WRHLGTNMMV       420
     LGLMGTRVHD EIGRGNFLAI YFASGVMGSV FSLTRSVILG RLGMTSLGAS AATSGIVAAW       480
     CMSHFNDKLT MWILPQGLQD QIWTYGWVFL TCLVGTEVFS LIAPAFLFRA WPLSRLTKMD       540
     HAAHLGGYAT GAGCGYTLMQ KRKERERKAR QSRWF                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page