(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE228

PENCW_13.PE228       Location/Qualifiers
FT   CDS             524168..524629
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946639"
FT                   /orf_name="Pc16g02280"
FT                   /product="Pc16g02280 protein"
FT                   /protein_id="CAP92898.1"
FT                   /db_xref="UniParc:UPI000183195E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B1"
FT                   /transl_table=1
FT                   /translation="MSTESLPITPGAFAEAIKELPIAVLYSKVSELTNSIAHLHRSNAE
FT                   LRAFLAESNDSEEDKKELEGYITENEGVAVSMNERILLLKTEVENRGQPWIELDELKIN
FT                   NDQEASPVTNGNETETETETETGVRPGSGAEAGAGQESHDREDGDGVYL"
     MSTESLPITP GAFAEAIKEL PIAVLYSKVS ELTNSIAHLH RSNAELRAFL AESNDSEEDK        60
     KELEGYITEN EGVAVSMNER ILLLKTEVEN RGQPWIELDE LKINNDQEAS PVTNGNETET       120
     ETETETGVRP GSGAEAGAGQ ESHDREDGDG VYL                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page