(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE229

PENCW_13.PE229       Location/Qualifiers
FT   CDS             join(complement(526548..526570),complement(526018..526286),
FT                   complement(525846..525960),complement(525278..525794))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128413"
FT                   /orf_name="Pc16g02290"
FT                   /product="Pc16g02290 protein"
FT                   /protein_id="CAP92899.1"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="UniParc:UPI000183195F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B2"
FT                   /transl_table=1
FT                   /translation="MATFFQSVRQGFGRGGNNKSNNPPKSPAQTSAPQHQATMSNSPSI
FT                   SSSLSVENQANDPEGPKYFFQEKYAPLNVRGNFLTLCACPKNVELGEWLAHQIVEQYRL
FT                   LHGMLQVIQEVNTVTGLPICNENTCPTMSAGRLTYTWLVDGRAAKISAPKFINRVEKWI
FT                   VSKIHDPVMFPTEKVNGTPETSAIKEANGASATPSDPANPDEWIGKSSGFPPTFYKDCQ
FT                   GIMKQMFRCYAHLYHAHWLNPFWHINKHDVLNMCFVHFVTVSKYYGLVSDKEMEPMQPL
FT                   IELFIKQQRVPPEALNGGHWAQQATT"
     MATFFQSVRQ GFGRGGNNKS NNPPKSPAQT SAPQHQATMS NSPSISSSLS VENQANDPEG        60
     PKYFFQEKYA PLNVRGNFLT LCACPKNVEL GEWLAHQIVE QYRLLHGMLQ VIQEVNTVTG       120
     LPICNENTCP TMSAGRLTYT WLVDGRAAKI SAPKFINRVE KWIVSKIHDP VMFPTEKVNG       180
     TPETSAIKEA NGASATPSDP ANPDEWIGKS SGFPPTFYKD CQGIMKQMFR CYAHLYHAHW       240
     LNPFWHINKH DVLNMCFVHF VTVSKYYGLV SDKEMEPMQP LIELFIKQQR VPPEALNGGH       300
     WAQQATT                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page