(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE230

PENCW_13.PE230       Location/Qualifiers
FT   CDS             join(526920..527068,527120..527285,527339..528331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128414"
FT                   /orf_name="Pc16g02300"
FT                   /product="Pc16g02300 protein"
FT                   /protein_id="CAP92900.1"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniParc:UPI0001831960"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B3"
FT                   /transl_table=1
FT                   /translation="MSSDEEGVRRPSNGNESPAHSNAHDSGADQMDEGDDLFGSDGEGG
FT                   LDDIEPHRTLDDEQLDSGDDENRYDRREDRMEDVAEEQQEVNVADQDLARAPVPLTNDG
FT                   EVYTMRVPDFLSIEGEEFNPETYVPPPYQTAATSLCWRKDPADESLLQSNARIIKWEDG
FT                   SITLQLASAPLEQYRIASKPLAPLTKSGDYDHKLDSHVYLAAGLETAQVFRLTSHITQG
FT                   LTVLPTTLETDDAVQRLQEQLAAAARGSKQTAAGTAPRYELTEDPELAGKRAEMMEKEA
FT                   IKAERRRQQLADREADRGRRHGATRPGPSGLSVGGLEDAGLLTTRPRAKPRRQNRRGEI
FT                   YTDDEEEDYSRGARNREDEYDEDDGFLVGSDEEVEEEAEDEEEELEDEDMDAEGEDDVE
FT                   AAPAKAGRSKPEPQVRDGTPPARKKNRYVVDDEDDE"
     MSSDEEGVRR PSNGNESPAH SNAHDSGADQ MDEGDDLFGS DGEGGLDDIE PHRTLDDEQL        60
     DSGDDENRYD RREDRMEDVA EEQQEVNVAD QDLARAPVPL TNDGEVYTMR VPDFLSIEGE       120
     EFNPETYVPP PYQTAATSLC WRKDPADESL LQSNARIIKW EDGSITLQLA SAPLEQYRIA       180
     SKPLAPLTKS GDYDHKLDSH VYLAAGLETA QVFRLTSHIT QGLTVLPTTL ETDDAVQRLQ       240
     EQLAAAARGS KQTAAGTAPR YELTEDPELA GKRAEMMEKE AIKAERRRQQ LADREADRGR       300
     RHGATRPGPS GLSVGGLEDA GLLTTRPRAK PRRQNRRGEI YTDDEEEDYS RGARNREDEY       360
     DEDDGFLVGS DEEVEEEAED EEEELEDEDM DAEGEDDVEA APAKAGRSKP EPQVRDGTPP       420
     ARKKNRYVVD DEDDE                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page