(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE231

PENCW_13.PE231       Location/Qualifiers
FT   CDS             join(complement(529941..530034),complement(528653..529884))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128415"
FT                   /orf_name="Pc16g02310"
FT                   /product="Pc16g02310 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92901.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831961"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B4"
FT                   /transl_table=1
FT                   /translation="MSLLHEYEGGLPLPITNSLSEPKRHAACDECRKRKLKCSGELTGC
FT                   SRCTKQSLSCNYSIQKQMGRPPKKRARTDNEGVDFPALSEAEIWPSPEDSQQSSLGMDT
FT                   VTLTDADHLCPQIFWRPGTNMNLPQSQPSDLSQPADLLSGYEDHNHAWRPDRLKQPNLP
FT                   VPASSSPWPDFSAISEATAMPMPFPNSPPFPSMHSLPLSPATSISSDSTTSGCPCLSYL
FT                   YLSLSHMTSISSFPVNSHTLCSLYIAARTARDVIRCQVCPKVFSTGLQNIMFIGTLLTV
FT                   TADAWLRVLRADAVELGTQSALPQYVSEALQSPDPAQYWKSWLHQVVRRAVIGGAVEPS
FT                   AMIACSEQPDLLSMIIEIENRQRRFHEPGKHPLGECNPIFMPDSAQSQDEDDHGEKKFL
FT                   CLRVVGSARDVIARFNFDPSEYPEGVEPVTATNKAHAGAYHA"
     MSLLHEYEGG LPLPITNSLS EPKRHAACDE CRKRKLKCSG ELTGCSRCTK QSLSCNYSIQ        60
     KQMGRPPKKR ARTDNEGVDF PALSEAEIWP SPEDSQQSSL GMDTVTLTDA DHLCPQIFWR       120
     PGTNMNLPQS QPSDLSQPAD LLSGYEDHNH AWRPDRLKQP NLPVPASSSP WPDFSAISEA       180
     TAMPMPFPNS PPFPSMHSLP LSPATSISSD STTSGCPCLS YLYLSLSHMT SISSFPVNSH       240
     TLCSLYIAAR TARDVIRCQV CPKVFSTGLQ NIMFIGTLLT VTADAWLRVL RADAVELGTQ       300
     SALPQYVSEA LQSPDPAQYW KSWLHQVVRR AVIGGAVEPS AMIACSEQPD LLSMIIEIEN       360
     RQRRFHEPGK HPLGECNPIF MPDSAQSQDE DDHGEKKFLC LRVVGSARDV IARFNFDPSE       420
     YPEGVEPVTA TNKAHAGAYH A                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page