(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE235

PENCW_13.PE235       Location/Qualifiers
FT   CDS             join(complement(537370..537499),complement(537202..537313),
FT                   complement(536626..537046))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128417"
FT                   /orf_name="Pc16g02350"
FT                   /product="Pc16g02350 protein"
FT                   /protein_id="CAP92905.1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniParc:UPI0001831965"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B8"
FT                   /transl_table=1
FT                   /translation="MSGHHHDHGHCHGEDHDHTNDITPAIQSLLYSQINFDLITTLNET
FT                   TPNSGASIVQKTWAERLNDKPELESDADEQLLMTIPFNGQVNVHSLLLYTAPTNSAPRT
FT                   VKLFKNRDDLDFSTASELHPAQTIEVPRPVPGADVFELPLNRAHWNATTSVTLFFEDNW
FT                   SDGEEDVTKVGYVGFKGQFMKLTREPVNFLYEAAANPQDHVSIPGVSGIGGRIMPGQ"
     MSGHHHDHGH CHGEDHDHTN DITPAIQSLL YSQINFDLIT TLNETTPNSG ASIVQKTWAE        60
     RLNDKPELES DADEQLLMTI PFNGQVNVHS LLLYTAPTNS APRTVKLFKN RDDLDFSTAS       120
     ELHPAQTIEV PRPVPGADVF ELPLNRAHWN ATTSVTLFFE DNWSDGEEDV TKVGYVGFKG       180
     QFMKLTREPV NFLYEAAANP QDHVSIPGVS GIGGRIMPGQ                             220
//

If you have problems or comments...

PBIL Back to PBIL home page