(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE236

PENCW_13.PE236       Location/Qualifiers
FT   CDS             join(complement(539808..540032),complement(538084..539742),
FT                   complement(537892..538026))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671375"
FT                   /orf_name="Pc16g02360"
FT                   /product="Pc16g02360 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP92906.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831966"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7B9"
FT                   /transl_table=1
FT                   /translation="MASEQELSTSFIPALYKPAALLPIARHKKNLLYLVEKYPVTIVVG
FT                   QTGSGKTTQLPQYLDQAGWCEDGKIIAVTQPRRVAATTVATRVAEEMRCKVGEEVGYSI
FT                   RFEDLTSPATRIKFLTDGMLLREALVDPLLSRYSVIMVDEAHERSLGTDVLLGTLKKIR
FT                   KKRPELRIIVSSATLQAEDFLRFFAGEEYQPEAEPEDLGGSVGRIISLEGRMYPVDILF
FT                   LDSPAEDYIERAVKTVFDIHTQEPEGDVLLFLTGREEIDTAIQLISERAATLHPKAPSL
FT                   LPLPLYAGLTTEQQMYVFEPTPENTRKVIVSTNIAEASVTIDGIVYVIDSGFAKLRAYN
FT                   PNTGIDTLTAVPISKASATQRAGRAGRTKPGKCFRLYTQQAFEQMPEARVPEIQRSNLA
FT                   PVIMQLKALGIDNIVRFDFLTPPPAELIIRALELLSSLGAVDDYAKLTKPLGMRMAEIA
FT                   LDPMMAKVLLVAPSFNCLSEILTIAAMVNLQGTVWVQHAGDKRSAESHRRKFAVEEGDH
FT                   LTYLNVYQAFVTKGKKDSKWCRDNLLNYRALLRAVSIRGQLKRYLERFGIQVDETLSSR
FT                   HGAADLSKQPEQIRRCLTTGYFAHAAKMQPDGTFKTVSGGLTLHAHPTSLMFNRKADWV
FT                   IFHEIMQTGEKTYIRDVTKIEKSYLLEYAPDYYRVRQ"
     MASEQELSTS FIPALYKPAA LLPIARHKKN LLYLVEKYPV TIVVGQTGSG KTTQLPQYLD        60
     QAGWCEDGKI IAVTQPRRVA ATTVATRVAE EMRCKVGEEV GYSIRFEDLT SPATRIKFLT       120
     DGMLLREALV DPLLSRYSVI MVDEAHERSL GTDVLLGTLK KIRKKRPELR IIVSSATLQA       180
     EDFLRFFAGE EYQPEAEPED LGGSVGRIIS LEGRMYPVDI LFLDSPAEDY IERAVKTVFD       240
     IHTQEPEGDV LLFLTGREEI DTAIQLISER AATLHPKAPS LLPLPLYAGL TTEQQMYVFE       300
     PTPENTRKVI VSTNIAEASV TIDGIVYVID SGFAKLRAYN PNTGIDTLTA VPISKASATQ       360
     RAGRAGRTKP GKCFRLYTQQ AFEQMPEARV PEIQRSNLAP VIMQLKALGI DNIVRFDFLT       420
     PPPAELIIRA LELLSSLGAV DDYAKLTKPL GMRMAEIALD PMMAKVLLVA PSFNCLSEIL       480
     TIAAMVNLQG TVWVQHAGDK RSAESHRRKF AVEEGDHLTY LNVYQAFVTK GKKDSKWCRD       540
     NLLNYRALLR AVSIRGQLKR YLERFGIQVD ETLSSRHGAA DLSKQPEQIR RCLTTGYFAH       600
     AAKMQPDGTF KTVSGGLTLH AHPTSLMFNR KADWVIFHEI MQTGEKTYIR DVTKIEKSYL       660
     LEYAPDYYRV RQ                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page