(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE237

PENCW_13.PE237       Location/Qualifiers
FT   CDS             join(540337..540357,540417..540726,540790..541032,
FT                   541087..541353,541406..541800)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671376"
FT                   /orf_name="Pc16g02370"
FT                   /product="Pc16g02370 protein"
FT                   /protein_id="CAP92907.1"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI0001831967"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C0"
FT                   /transl_table=1
FT                   /translation="MSEEDKMNTPGRPLGALNSPNSPRAESPTTARPMDFDDEPQETGV
FT                   ITSSPVAPQPAAAEPAPPKPPRPLSPREQSENTLREAFPSIEPGVVKAVLTASNWHVER
FT                   AFNALLGMTDPKAQEEMTPPPKPPRPTQQSTAAQRQLEADEMYARQLSEHYNATGRRAP
FT                   PPGWESDPRYQRPRGSEDSEEREYSFFDDDLPVIRENLRKGFLETQNKVNSWVTNLKKR
FT                   IDGDDLDEEPSQNQRETTHARPRRSGDMGRRSGDRERYDADPQVLSDDFSALELRDGEA
FT                   PPPRPPRPGNSSLKPSVSPSPDRRRVSFQEGPPTEIDNSYDASTPSKRLSSTGSKSSKW
FT                   QPLSTVEPSPVAENDPFSLGDSDDEKEIKTKEQTTSSEGDQLKHATVESVSDEVGSSKG
FT                   PDTKGASKPESK"
     MSEEDKMNTP GRPLGALNSP NSPRAESPTT ARPMDFDDEP QETGVITSSP VAPQPAAAEP        60
     APPKPPRPLS PREQSENTLR EAFPSIEPGV VKAVLTASNW HVERAFNALL GMTDPKAQEE       120
     MTPPPKPPRP TQQSTAAQRQ LEADEMYARQ LSEHYNATGR RAPPPGWESD PRYQRPRGSE       180
     DSEEREYSFF DDDLPVIREN LRKGFLETQN KVNSWVTNLK KRIDGDDLDE EPSQNQRETT       240
     HARPRRSGDM GRRSGDRERY DADPQVLSDD FSALELRDGE APPPRPPRPG NSSLKPSVSP       300
     SPDRRRVSFQ EGPPTEIDNS YDASTPSKRL SSTGSKSSKW QPLSTVEPSP VAENDPFSLG       360
     DSDDEKEIKT KEQTTSSEGD QLKHATVESV SDEVGSSKGP DTKGASKPES K                411
//

If you have problems or comments...

PBIL Back to PBIL home page