(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE238

PENCW_13.PE238       Location/Qualifiers
FT   CDS             join(complement(542570..542656),complement(542371..542448),
FT                   complement(542192..542260))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671377"
FT                   /orf_name="Pc16g02380"
FT                   /product="Pc16g02380 protein"
FT                   /protein_id="CAP92908.1"
FT                   /db_xref="InterPro:IPR022214"
FT                   /db_xref="UniParc:UPI0001831968"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C1"
FT                   /transl_table=1
FT                   /translation="MPPKSQEADDKRQAAREVIDILQEISDLLNTNLDRTELSLCVSLI
FT                   ENGVNPDALATVIKDLRKETGSKRVGNAHAVE"
     MPPKSQEADD KRQAAREVID ILQEISDLLN TNLDRTELSL CVSLIENGVN PDALATVIKD        60
     LRKETGSKRV GNAHAVE                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page