(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE239

PENCW_13.PE239       Location/Qualifiers
FT   CDS             543254..544171
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977312"
FT                   /orf_name="Pc16g02390"
FT                   /product="Pc16g02390 protein"
FT                   /protein_id="CAP92909.1"
FT                   /db_xref="UniParc:UPI0001831969"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7C2"
FT                   /transl_table=1
FT                   /translation="MSYEITTHSGGARCFLIPPKKPSAWQQFRDEPCLFLARKLSAWRP
FT                   TNLPKLPENPVTVVCISNTYHERPEIPPGDILIHAGDLTSDGSLAELQITLNWLQAQPH
FT                   PIKIAVAGRADRYLDKMKKGGRRWRHGHRERAYWGDIIYLEHQHLTVTAPNGRQLRIYG
FT                   SPYSPMTVPSLAFQYSDSDNIWDRVPDNMDILITHTPPYTHRDSLRGCLHLLNHIWMDP
FT                   PRLHVFGCAREHHGCEFLYYDALQAAVERIEDVGGGFSNLLMVVKGLVQSFFRPDIKAK
FT                   SVLVNACTNGGLWDPERQPISVVI"
     MSYEITTHSG GARCFLIPPK KPSAWQQFRD EPCLFLARKL SAWRPTNLPK LPENPVTVVC        60
     ISNTYHERPE IPPGDILIHA GDLTSDGSLA ELQITLNWLQ AQPHPIKIAV AGRADRYLDK       120
     MKKGGRRWRH GHRERAYWGD IIYLEHQHLT VTAPNGRQLR IYGSPYSPMT VPSLAFQYSD       180
     SDNIWDRVPD NMDILITHTP PYTHRDSLRG CLHLLNHIWM DPPRLHVFGC AREHHGCEFL       240
     YYDALQAAVE RIEDVGGGFS NLLMVVKGLV QSFFRPDIKA KSVLVNACTN GGLWDPERQP       300
     ISVVI                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page