(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE240

PENCW_13.PE240       Location/Qualifiers
FT   CDS             544665..545183
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217070" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671378"
FT                   /orf_name="Pc16g02400"
FT                   /product="Pc16g02400 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP92910.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000183196A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H733"
FT                   /transl_table=1
FT                   /translation="MAPQYETGGMGGMPGLTISDIHALKRNEALEILARISRVEKKTFP
FT                   TNEAFPFGEDLWRKKPNTRVLYAIRAKGSQSDLIAYAVYVRQKGIALLHKVCVTEPNRR
FT                   RGVGQEVLSYIQQRLRKEGCQYIQLWVDQAREPARALYLRIGFEEREVIPDYYAPGRTG
FT                   IKMVLDLQA"
     MAPQYETGGM GGMPGLTISD IHALKRNEAL EILARISRVE KKTFPTNEAF PFGEDLWRKK        60
     PNTRVLYAIR AKGSQSDLIA YAVYVRQKGI ALLHKVCVTE PNRRRGVGQE VLSYIQQRLR       120
     KEGCQYIQLW VDQAREPARA LYLRIGFEER EVIPDYYAPG RTGIKMVLDL QA               172
//

If you have problems or comments...

PBIL Back to PBIL home page