(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE241

PENCW_13.PE241       Location/Qualifiers
FT   CDS             545709..548537
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208599" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977313"
FT                   /orf_name="Pc16g02410"
FT                   /product="Pc16g02410 protein"
FT                   /function="calcium ion binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92911.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniParc:UPI000183196B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H734"
FT                   /transl_table=1
FT                   /translation="MAFFLTIVLVFLSVASAASLSANYPINAQLPPVARVSQPFRFEFA
FT                   QSTFANTDADTKYSLLNAPSWLEVDSSSLALYGTPDSSDSGANEFKLVASNGSEKDSMD
FT                   VTLIVTADQGPTVNKPLVPQLQKSGPVSYPATLFIHPGRQFSIEFDQDTFDNTHPSTIY
FT                   YGTSPNNAPLPPWITFDPAALKFAGNSPAFPGAGPQTFTFQLVASDVAGYSAANVTFEL
FT                   SIGPHILTFNETVQNFNLTRGEEFNSPKFTSLLSMDGSPVSIKELEKVDAELPNWLNLD
FT                   KENISLSGTPPKDAVNQNITISVTDTFHDQAHLMVRLEFLKLFLDTVNGCEAAIGQDFK
FT                   FVFNQSILTDDSVQLEVDLDNDLAWLTYFSDNKTLYGHVPDDMDPKKFTIPLTAYQGST
FT                   EDTMDFVLDVLKASDTHSNPTDPFTDTGSPDHKKAGIIAISVVVPLVVILSLLILFCCW
FT                   RSRKNSPTIEEGTSDRKAPPRPVRPDVPNCQPSMTERPSRDDNSDDWMSPISPSSIPKL
FT                   ELGPAWNVASFDKRENPVNFVIPEPIIPPRSPARNSPTRGGFVPRRDTITQEDKPVEAV
FT                   SPSKKQNNRLSYTNSPVRRRTTNRSRREPLKPIQPRAMKRESLQSSKSKRYSKRSSGIS
FT                   SIASGLPVRFSGAGHGAGGFGPPGHGVVHTSWQNARASMINDESSLTNMAPMFSRPPAA
FT                   GRMRHSMASSIPENYRRMTLRTVEPDDSIISESDSLEAFVHSRAKHRNSSNPLFSAQIS
FT                   RRTSSGMRALDRNRSMRSRADTVSVSTFSDEYRQSMQDRPLSTAISASEYGDDNTTNNN
FT                   SRFSQYQSQTGLFPLAEGSAYGQSQLSIAQDYRGAISPLPQCWSENSMGSARQLEGQGN
FT                   SQPQKVNDENAMPPSSSMISDLDEHLSRKVNPNKGANHEWWLSSPVEPPRPLKNSDNRS
FT                   LPVASSGELAFV"
     MAFFLTIVLV FLSVASAASL SANYPINAQL PPVARVSQPF RFEFAQSTFA NTDADTKYSL        60
     LNAPSWLEVD SSSLALYGTP DSSDSGANEF KLVASNGSEK DSMDVTLIVT ADQGPTVNKP       120
     LVPQLQKSGP VSYPATLFIH PGRQFSIEFD QDTFDNTHPS TIYYGTSPNN APLPPWITFD       180
     PAALKFAGNS PAFPGAGPQT FTFQLVASDV AGYSAANVTF ELSIGPHILT FNETVQNFNL       240
     TRGEEFNSPK FTSLLSMDGS PVSIKELEKV DAELPNWLNL DKENISLSGT PPKDAVNQNI       300
     TISVTDTFHD QAHLMVRLEF LKLFLDTVNG CEAAIGQDFK FVFNQSILTD DSVQLEVDLD       360
     NDLAWLTYFS DNKTLYGHVP DDMDPKKFTI PLTAYQGSTE DTMDFVLDVL KASDTHSNPT       420
     DPFTDTGSPD HKKAGIIAIS VVVPLVVILS LLILFCCWRS RKNSPTIEEG TSDRKAPPRP       480
     VRPDVPNCQP SMTERPSRDD NSDDWMSPIS PSSIPKLELG PAWNVASFDK RENPVNFVIP       540
     EPIIPPRSPA RNSPTRGGFV PRRDTITQED KPVEAVSPSK KQNNRLSYTN SPVRRRTTNR       600
     SRREPLKPIQ PRAMKRESLQ SSKSKRYSKR SSGISSIASG LPVRFSGAGH GAGGFGPPGH       660
     GVVHTSWQNA RASMINDESS LTNMAPMFSR PPAAGRMRHS MASSIPENYR RMTLRTVEPD       720
     DSIISESDSL EAFVHSRAKH RNSSNPLFSA QISRRTSSGM RALDRNRSMR SRADTVSVST       780
     FSDEYRQSMQ DRPLSTAISA SEYGDDNTTN NNSRFSQYQS QTGLFPLAEG SAYGQSQLSI       840
     AQDYRGAISP LPQCWSENSM GSARQLEGQG NSQPQKVNDE NAMPPSSSMI SDLDEHLSRK       900
     VNPNKGANHE WWLSSPVEPP RPLKNSDNRS LPVASSGELA FV                          942
//

If you have problems or comments...

PBIL Back to PBIL home page