(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE242

PENCW_13.PE242       Location/Qualifiers
FT   CDS             join(550223..550258,550608..550926,550983..551056,
FT                   551123..551207,551276..551482,551538..551824,5
FT                   51894..552205)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946642"
FT                   /orf_name="Pc16g02420"
FT                   /product="Pc16g02420 protein"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="CAP92912.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0001831A3D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H735"
FT                   /transl_table=1
FT                   /translation="MGQTLSEPVVEKTSSEGGDDCCVYGVSAMQGWRISMEDAHATVLD
FT                   LQAKYTGTDDKPTDPEHRLAFFGVYDGHGGDKVALFTGENLHKIVSRQDAFAKGDIEQA
FT                   LKDGFLATDRAILEDPRYEEEVSGCTASTAIISQKKIWVANAGDSRSVLGVKGRAKPLS
FT                   FDHKPQNEGEKARITAAGGFVDFGRVNGNLALSRAIGDFEFKKSPELSPEQQIVTAYPD
FT                   VTVHELTNDDEFLVIACDGIWDCQSSQAVVEFVRRGIAAKQPLAQICENMMDNCLASNS
FT                   ETGGVGCDNMTMSVIGLLQGKTKEEWYNQIAERVANGDGPCAPPEYGKSPEEPESFEDT
FT                   PDEYDLEMERSRGFSVRSGRIILLGDGTEVITDQNDEELFDQTEEDQDLTNQVQHESGT
FT                   RNDRQATPGPQGKQENGSGTSAQISESPASTDAEKEKPAS"
     MGQTLSEPVV EKTSSEGGDD CCVYGVSAMQ GWRISMEDAH ATVLDLQAKY TGTDDKPTDP        60
     EHRLAFFGVY DGHGGDKVAL FTGENLHKIV SRQDAFAKGD IEQALKDGFL ATDRAILEDP       120
     RYEEEVSGCT ASTAIISQKK IWVANAGDSR SVLGVKGRAK PLSFDHKPQN EGEKARITAA       180
     GGFVDFGRVN GNLALSRAIG DFEFKKSPEL SPEQQIVTAY PDVTVHELTN DDEFLVIACD       240
     GIWDCQSSQA VVEFVRRGIA AKQPLAQICE NMMDNCLASN SETGGVGCDN MTMSVIGLLQ       300
     GKTKEEWYNQ IAERVANGDG PCAPPEYGKS PEEPESFEDT PDEYDLEMER SRGFSVRSGR       360
     IILLGDGTEV ITDQNDEELF DQTEEDQDLT NQVQHESGTR NDRQATPGPQ GKQENGSGTS       420
     AQISESPAST DAEKEKPAS                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page