(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE243

PENCW_13.PE243       Location/Qualifiers
FT   CDS             join(553385..553893,553997..554347,554400..554808,
FT                   554887..555024)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128418"
FT                   /orf_name="Pc16g02430"
FT                   /product="Pc16g02430 protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP92913.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001831A3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H736"
FT                   /transl_table=1
FT                   /translation="MSPSTSPAGKRKRSASHLPAPVPKNVTADLQPSSRDASGEEGGED
FT                   STGPANANSNSSNGTRHPSKRARKAAAADAASHTEVNGVEPVNKEDPGEPSETTVASSD
FT                   IEGGPRSRPGLHIDLPEDDEPVTEEQMAPPVFGRLQDPVGYHTNPPPTGRPVRVYADGV
FT                   FDLFHLGHMRQLEQAKKAFPDTYLIVGVTGDEETHLRKGLTVLSGAERAETIRHCKWVD
FT                   EVIPCCPWIVTPEFLSEHKIDYVAHDDLPYGAAEGDDIYAPIKEQGKFLVTQRTEGVST
FT                   TGIITRVVRDYDQYISRQFKRGASRQELNVSWLKKNELEIKRHVAELRDNIRNNWTMTG
FT                   QELGRELRQIWQNSRPNSPAPSARNSMDWGMRGPLTSPTGGSKSHLSRVGAEHNRADSP
FT                   MGSRRNEDFATGYSLGLIGGVRAWMARSRQSLQEPPSGMHSPTDEELEPEHNNGYEEEV
FT                   RGRTGHVSAK"
     MSPSTSPAGK RKRSASHLPA PVPKNVTADL QPSSRDASGE EGGEDSTGPA NANSNSSNGT        60
     RHPSKRARKA AAADAASHTE VNGVEPVNKE DPGEPSETTV ASSDIEGGPR SRPGLHIDLP       120
     EDDEPVTEEQ MAPPVFGRLQ DPVGYHTNPP PTGRPVRVYA DGVFDLFHLG HMRQLEQAKK       180
     AFPDTYLIVG VTGDEETHLR KGLTVLSGAE RAETIRHCKW VDEVIPCCPW IVTPEFLSEH       240
     KIDYVAHDDL PYGAAEGDDI YAPIKEQGKF LVTQRTEGVS TTGIITRVVR DYDQYISRQF       300
     KRGASRQELN VSWLKKNELE IKRHVAELRD NIRNNWTMTG QELGRELRQI WQNSRPNSPA       360
     PSARNSMDWG MRGPLTSPTG GSKSHLSRVG AEHNRADSPM GSRRNEDFAT GYSLGLIGGV       420
     RAWMARSRQS LQEPPSGMHS PTDEELEPEH NNGYEEEVRG RTGHVSAK                    468
//

If you have problems or comments...

PBIL Back to PBIL home page