(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE244

PENCW_13.PE244       Location/Qualifiers
FT   CDS             complement(555744..556523)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000179081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946643"
FT                   /orf_name="Pc16g02440"
FT                   /product="Putative uncharacterized protein Pc16g02440 "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92914.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniParc:UPI0001831A3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H737"
FT                   /transl_table=1
FT                   /translation="MDIPISPSACLLLGSLPLLALSEWNSTSHTGTAVFKMLSSLAFLS
FT                   SPLLLSTEWTDYRRLITIGLGFSLLGDFFLIPSHSEFHDLNTTPSATSEAKSEGNVSIS
FT                   FQLGIVAFAAAHIAYTIAFLQDSSDTSWMTFAVTFVGTLGAARWLGVIYPPPSFSLRNN
FT                   VLGLAIAPDMKPLVSVYAVIIGTMFAAATSTSPLTVPTEWWHSRALGAAMFVVSDLFVA
FT                   KNAFGKSSAKGRGWLRIFVGYALYFWAQMVIAGTVRA"
     MDIPISPSAC LLLGSLPLLA LSEWNSTSHT GTAVFKMLSS LAFLSSPLLL STEWTDYRRL        60
     ITIGLGFSLL GDFFLIPSHS EFHDLNTTPS ATSEAKSEGN VSISFQLGIV AFAAAHIAYT       120
     IAFLQDSSDT SWMTFAVTFV GTLGAARWLG VIYPPPSFSL RNNVLGLAIA PDMKPLVSVY       180
     AVIIGTMFAA ATSTSPLTVP TEWWHSRALG AAMFVVSDLF VAKNAFGKSS AKGRGWLRIF       240
     VGYALYFWAQ MVIAGTVRA                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page